TkA01G515460 | RubberDandelionOmics

Gene overview

TkA01G515460

Reference: TK1151 Chr: Chr01 Coordinates: 129175473-129177521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · TkA01G515460|TK1151|cDNA

ATGACTTCAATACATTTATATTTAATATCTGAACTTGGATTTCGATTTTCAGGTGGAAGAGTAAACAATGGCGTTAACAAAGAAGGTGTTGACTACTACAATAACCTAATCAATGAGCTCATACTCCATGGAATTACTCCATATGTCACTTTGTTTCATTGGGACACTCCTAACTGCCTAGAAAAAGAATACATGGGTTTCTTAGATAAAAAAATCATATGCGATTTTAAAAGTTACGTGGGATTTTGCTTTTGGGAATT...

CDS

Download CDS FASTA

1317 bp · TkA01G515460|TK1151|CDS

ATGACTTCAATACATTTATATTTAATATCTGAACTTGGATTTCGATTTTCAGGTGGAAGAGTAAACAATGGCGTTAACAAAGAAGGTGTTGACTACTACAATAACCTAATCAATGAGCTCATACTCCATGGAATTACTCCATATGTCACTTTGTTTCATTGGGACACTCCTAACTGCCTAGAAAAAGAATACATGGGTTTCTTAGATAAAAAAATCATATGCGATTTTAAAAGTTACGTGGGATTTTGCTTTTGGGAATT...

Protein

Download Protein FASTA

438 aa · TkA01G515460|TK1151|PROTEIN

MTSIHLYLISELGFRFSGGRVNNGVNKEGVDYYNNLINELILHGITPYVTLFHWDTPNCLEKEYMGFLDKKIICDFKSYVGFCFWEFGDRVVNWITLNEPANYAISGYDLGVFPPGRGVAGSGVGNGGTEPYIVTHNLLLCHAAAVELYRERFQASQGGKIGITLDATYFLPLDPQKVEDKDAALRALNFHFGWYMEPLFSGKYPDIMRKNVGDRLPEFTVEEAKLLKGAYDFLGLNYYCSNYATTAVPTDVVSYSNDIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G515460`
TK1151 ID	TkA01G515460
OH-1004 ID	LXL04_001741
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 96.119 / OH-1004 79.584 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G515460

Location Chr01:129175473-129177521 (+)

Description Similar to BGLU11: Beta-glucosidase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0474800`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides and laminaribiose.	No verified direct reference in this release
`UniProt: B8AVF0`	Hydrolyzes p-nitrophenyl beta-D-glucoside, p-nitrophenyl beta-D-galactoside, p-nitrophenyl beta-D-xyloside, p-nitrophenyl beta-D-fucoside, p-nitrophenyl beta-L-arabinoside, cello-oligosaccharides and laminaribiose.	No verified direct reference in this release
`UniProt: Q7XKV5`	Beta-glucosidase 11.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001741 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0004338 glucan exo-1,3-beta-glucosidase activity Molecular Function

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0047701 beta-L-arabinosidase activity Molecular Function

GO:0080083 beta-gentiobiose beta-glucosidase activity Molecular Function

KEGG gene cross-reference

ag:AAL93619

dosa:Os04g0474800

dosa:Os06g0320200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · TkA01G515460 · TK1151

Plastid0.156

Rank 2 · TkA01G515460 · TK1151

Lysosome / Vacuole0.134

Rank 3 · TkA01G515460 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA01G515460 · TK1151

Nucleus0.112

Rank 5 · TkA01G515460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_122-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G515460	`PF00232`	Glyco_hydro_1	22	402	2.9e-111	373.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XKV4`	Oryza sativa subsp. japonica	sp\|Q7XKV4\|BGL12_ORYSJ Beta-glucosidase 12	51.200%	Swiss-Prot	High
`B8AVF0`	Oryza sativa subsp. indica	sp\|B8AVF0\|BGL12_ORYSI Beta-glucosidase 12	50.900%	Swiss-Prot	High
`Q7XKV5`	Oryza sativa subsp. japonica	sp\|Q7XKV5\|BGL11_ORYSJ Beta-glucosidase 11	50.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card