TkA01G514860 | RubberDandelionOmics

Gene overview

TkA01G514860

Reference: TK1151 Chr: Chr01 Coordinates: 129003997-129006433 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1574 bp · TkA01G514860|TK1151|cDNA

GTAACGGCCTCTTCCGTCCACCGCGTCCTCTCGTCAGTCGTAAAAAGTCCCAAAATTCAAGGTTGTAAATATGCAGGAGGCAATTTGCTGCACAACATCTTGGATTTCTTCGAACTCCATTCCTTCTTCGCCAGTCAATCACACATTCTATGATACTCGATTCACTTTCAGATTCCTAAGGAACAAACACATCGCCTCATTTCCTTGTGTGCGAGCTCAACAGCCTAAAGCTACCGATGCTGATGAACCTGCAATTACTA...

CDS

Download CDS FASTA

1176 bp · TkA01G514860|TK1151|CDS

ATGCAGGAGGCAATTTGCTGCACAACATCTTGGATTTCTTCGAACTCCATTCCTTCTTCGCCAGTCAATCACACATTCTATGATACTCGATTCACTTTCAGATTCCTAAGGAACAAACACATCGCCTCATTTCCTTGTGTGCGAGCTCAACAGCCTAAAGCTACCGATGCTGATGAACCTGCAATTACTATTCAATCAAGGAGTCCCGATATTAGAAACTCTCCAAGTGACATAGCTGCTACTCAAGGGATAAAAATCAG...

Protein

Download Protein FASTA

391 aa · TkA01G514860|TK1151|PROTEIN

MQEAICCTTSWISSNSIPSSPVNHTFYDTRFTFRFLRNKHIASFPCVRAQQPKATDADEPAITIQSRSPDIRNSPSDIAATQGIKIRRRPPTGPPQHHVGPFEFRLQNEGNTPRNILEEIVWNKDTEVAQMREKKPLISLKKALDNAPPPRDFIGALKTSYLQTGMPALIAEVKKASPSRGVLREDFDPVEIAKAYEKGGAACLSVLTDAKYFQGSFENLEAIRNAGVKCPLLCKEFIVDAWQLYYARAKGADAVLLIAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G514860`
TK1151 ID	TkA01G514860
OH-1004 ID	LXL04_001757
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G514860

Location Chr01:129003997-129006433 (-)

Description Similar to IGPS: Indole-3-glycerol phosphate synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04400`	Indole-3-glycerol phosphate synthase required for tryptophan biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001757 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004425 indole-3-glycerol-phosphate synthase activity Molecular Function

GO:0004640 phosphoribosylanthranilate isomerase activity Molecular Function

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G04400

cyp:PCC8801_3489

cyt:cce_2305

mar:MAE_45030

syn:slr0546

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA01G514860 · TK1151

Mitochondrion0.026

Rank 2 · TkA01G514860 · TK1151

Nucleus0.019

Rank 3 · TkA01G514860 · TK1151

Cytoplasm0.018

Rank 4 · TkA01G514860 · TK1151

Peroxisome0.014

Rank 5 · TkA01G514860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00218IGPS117-381 aa

PF00977His_biosynth186-226 aa

PF05690ThiG218-273 aa

PF04131NanE284-321 aa

PF04131NanE331-373 aa

PF05690ThiG337-376 aa

PF00977His_biosynth343-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G514860	`PF00218`	IGPS	117	381	7.6e-79	265.2
TkA01G514860	`PF00977`	His_biosynth	186	226	0.073	13.2
TkA01G514860	`PF05690`	ThiG	218	273	0.0026	17.9
TkA01G514860	`PF04131`	NanE	284	321	0.11	12.4
TkA01G514860	`PF04131`	NanE	331	373	0.11	12.4
TkA01G514860	`PF05690`	ThiG	337	376	0.0026	17.9
TkA01G514860	`PF00977`	His_biosynth	343	384	0.073	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49572`	Arabidopsis thaliana	sp\|P49572\|TRPC_ARATH Indole-3-glycerol phosphate synthase, chloroplastic	70.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card