TkA01G512000 | RubberDandelionOmics

Gene overview

TkA01G512000

Reference: TK1151 Chr: Chr01 Coordinates: 128296041-128297041 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkA01G512000|TK1151|cDNA

CTCCCGTGCCTCTAGAGTCTAGATATGCGCTGTATTTCTACACATTTCCGCACAAATACGTAGTAATTAGTGAATAGATCAGTATATCACCAAGAACCCAACAATGGCGAAACAAGAAGAGGTGATTCTACTAGATTTATGGGATGAAGGTCAGGATCGCTCTCGCTGAAAAGGGTGTTTCATACATGTACAAAGAAGAAGACTTGAGAAACAAGAGCCTGCTACTTTTGGAGATGAACCCGGTTCACAATAAAATCCCG...

CDS

Download CDS FASTA

618 bp · TkA01G512000|TK1151|CDS

ATGAAGGTCAGGATCGCTCTCGCTGAAAAGGGTGTTTCATACATGTACAAAGAAGAAGACTTGAGAAACAAGAGCCTGCTACTTTTGGAGATGAACCCGGTTCACAATAAAATCCCGGTCGTCATTCACAACGGCAAGCCGATCTGCGATTCTAGCATCATCGTTGAGTATATCGATGAAGTGTGGAAAGATAAATCTCCATTGTTACCTTCTGATGCTTACGGCAAAGCTCGAGCTAGGTTTATGTCTGACTTTATTGA...

Protein

Download Protein FASTA

205 aa · TkA01G512000|TK1151|PROTEIN

MKVRIALAEKGVSYMYKEEDLRNKSLLLLEMNPVHNKIPVVIHNGKPICDSSIIVEYIDEVWKDKSPLLPSDAYGKARARFMSDFIDKKVFLIGRNMCMTKGEEQEAARKEFIDCLKLIDGELGDKCYFEGESFGYLDLSLIPFNSRFHAYKMYGGFNIEHEFPKLFCWAKRCFENNESVSKSLPDPLKIHGFVQQMRKNLGLDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G512000`
TK1151 ID	TkA01G512000
OH-1004 ID	LXL04_001791
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 91.928 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G512000

Location Chr01:128296041-128297041 (-)

Description Similar to Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17180`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At1g78380`	Catalyzes the glutathionylation of 12-oxophytodienoate (OPDA).	Probing the diversity of the Arabidopsis glutathione S-transferase gene family.2002 · DOI: 10.1023/a:1015557300450 Organ-specific expression of glutathione S-transferases and the efficacy of herbicide safeners in Arabidopsis.2006 · DOI: 10.1104/pp.105.067199 Selective binding of glutathione conjugates of fatty acid derivatives by plant glutathione transferases.2009 · DOI: 10.1074/jbc.m109.020107
`At1g78370`	Exhibits glutathione-dependent thiol transferase activities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001791 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046256 2,4,6-trinitrotoluene catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G17170

ath:AT1G17180

ath:AT1G78380

nta:107782951

nta:107823949

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770

Rank 1 · TkA01G512000 · TK1151

Nucleus0.226

Rank 2 · TkA01G512000 · TK1151

Mitochondrion0.084

Rank 3 · TkA01G512000 · TK1151

Peroxisome0.072

Rank 4 · TkA01G512000 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA01G512000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13417GST_N_31-60 aa

PF02798GST_N2-60 aa

PF13409GST_N_22-60 aa

PF17172GST_N_435-89 aa

PF16865GST_C_588-167 aa

PF00043GST_C92-175 aa

PF13410GST_C_2104-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G512000	`PF13417`	GST_N_3	1	60	1.8e-11	44.9
TkA01G512000	`PF02798`	GST_N	2	60	5.1e-15	56.3
TkA01G512000	`PF13409`	GST_N_2	2	60	5.8e-11	43.6
TkA01G512000	`PF17172`	GST_N_4	35	89	0.039	15.3
TkA01G512000	`PF16865`	GST_C_5	88	167	0.00033	21.9
TkA01G512000	`PF00043`	GST_C	92	175	0.00051	20.9
TkA01G512000	`PF13410`	GST_C_2	104	171	4.5e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHH7`	Arabidopsis thaliana	sp\|Q9SHH7\|GSTUP_ARATH Glutathione S-transferase U25	59.800%	Swiss-Prot	High
`Q9ZRW8`	Arabidopsis thaliana	sp\|Q9ZRW8\|GSTUJ_ARATH Glutathione S-transferase U19	58.800%	Swiss-Prot	High
`Q8L7C9`	Arabidopsis thaliana	sp\|Q8L7C9\|GSTUK_ARATH Glutathione S-transferase U20	57.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card