TkA01G510920 | RubberDandelionOmics

Gene overview

TkA01G510920

Reference: TK1151 Chr: Chr01 Coordinates: 128007172-128012039 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3412 bp · TkA01G510920|TK1151|cDNA

AAAGACTAATTTACATTGATATAATTTGACCAAAAAAAGGCGAAAGAGGTAAAGTCGATCCGGGTTGAAAATTTAAAAAATTCAAATACCAAACGGTCTTCTTTCTCCATCTCACGCATAACGGCAAGAAAGTGAAATCGCCTCCAATCGAAATCATCGCATCTCAAACACACACTCACACAGAGACACACCAAAAAGATTGGGGAAAAAGCGTTCATTCCTCCCACTACTTTCTCTTTATTCAAGAAAATTGCAGTTGG...

CDS

Download CDS FASTA

3000 bp · TkA01G510920|TK1151|CDS

ATGGAAGATCAACGATTTGACCCACTTCTAATTACTGATGTCCACCAGCAACTGCAACATCAACAACAGCAACCCGAAACTCGTTTTCACTCACCTGTTGTGAGCTTTCAAACTTCTGTAATGGCTGATTATGATGATCTGTGTTTGGACAATCTAGAAGAAATTTCTTTGCGAACCCCAGAAGCAACGAAGGATAAAGTTTGTCATGATCTGTGTTTGGACAATCTTGAAGAAATTTCTTTTCGAACCCCAGAAGCAAC...

Protein

Download Protein FASTA

999 aa · TkA01G510920|TK1151|PROTEIN

MEDQRFDPLLITDVHQQLQHQQQQPETRFHSPVVSFQTSVMADYDDLCLDNLEEISLRTPEATKDKVCHDLCLDNLEEISFRTPEATKDKDCIDRIGNDVLDEISWRNLSPEAIRNEDVLDHKNVNSEFSLTSPELVISPRLPDAPDENHETSPTLLKRSIIELSFENDLTDGSKMNEFNENPSDSKEDLGSSESSFELLPFTSSQENDELQVKYENQKNELMKAKKELEIMKMENECKSKECEEALKSLRDLQNELMRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G510920`
TK1151 ID	TkA01G510920
OH-1004 ID	LXL04_001778
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G510920

Location Chr01:128007172-128012039 (-)

Description Similar to KIN14Q: Kinesin-like protein KIN-14Q

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72250`	Kinesin-like protein KIN-14Q.	No verified direct reference in this release
`At2g22610`	Kinesin-like protein KIN-14R.	No verified direct reference in this release
`At5g27550`	Kinesin-like protein KIN-14S.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0616000`	Kinesin-like protein KIN-14R.	No verified direct reference in this release
`Os03g0114000`	Kinesin-like protein KIN-14E.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G72250

ath:AT2G22610

dosa:Os03g0114000

dosa:Os12g0616000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.589

Rank 1 · TkA01G510920 · TK1151

Nucleus0.414

Rank 2 · TkA01G510920 · TK1151

Cell membrane0.090

Rank 3 · TkA01G510920 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G510920 · TK1151

Mitochondrion0.038

Rank 5 · TkA01G510920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03181BURP166-272 aa

PF16796Microtub_bd207-226 aa

PF14216DUF4326214-243 aa

PF03181BURP308-366 aa

PF14216DUF4326335-371 aa

PF16796Microtub_bd345-502 aa

PF00225Kinesin367-687 aa

PF14216DUF4326721-756 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G510920	`PF03181`	BURP	166	272	2.4	8.4
TkA01G510920	`PF16796`	Microtub_bd	207	226	1.1e-43	149.6
TkA01G510920	`PF14216`	DUF4326	214	243	2.0	9.8
TkA01G510920	`PF03181`	BURP	308	366	2.4	8.4
TkA01G510920	`PF14216`	DUF4326	335	371	2.0	9.8
TkA01G510920	`PF16796`	Microtub_bd	345	502	1.1e-43	149.6
TkA01G510920	`PF00225`	Kinesin	367	687	1.8e-112	376.3
TkA01G510920	`PF14216`	DUF4326	721	756	2.0	9.8
TkA01G510920	`PF16796`	Microtub_bd	738	763	1.1e-43	149.6
TkA01G510920	`PF00225`	Kinesin	751	800	1.8e-112	376.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IBQ9`	Arabidopsis thaliana	sp\|F4IBQ9\|KN14Q_ARATH Kinesin-like protein KIN-14Q	53.300%	Swiss-Prot	High
`F4IJK6`	Arabidopsis thaliana	sp\|F4IJK6\|KN14R_ARATH Kinesin-like protein KIN-14R	62.900%	Swiss-Prot	Low
`F4K4C5`	Arabidopsis thaliana	sp\|F4K4C5\|KN14S_ARATH Kinesin-like protein KIN-14S	47.600%	Swiss-Prot	Medium
`Q2QM62`	Oryza sativa subsp. japonica	sp\|Q2QM62\|KN14R_ORYSJ Kinesin-like protein KIN-14R	56.100%	Swiss-Prot	Medium
`B9FAF3`	Oryza sativa subsp. japonica	sp\|B9FAF3\|KN14E_ORYSJ Kinesin-like protein KIN-14E	64.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card