TkA01G510630 | RubberDandelionOmics

Gene overview

TkA01G510630

Reference: TK1151 Chr: Chr01 Coordinates: 127941407-127944295 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2112 bp · TkA01G510630|TK1151|cDNA

ATGTTATCGATCACTGTCCTTGTTGATTCAATAAACGAAGAAGGTGCTGTCCTTTTGGAGTTCAGATTCTCTCTTTCTGACCCAAATAACAATCTCCGTACATGGAATAATCAATCCGATTCATTTCCTTGTAATTGGATTGGTATAAACTGTACCATTGATCAGAAGGTAACGTCTATAAACCTCAGTAACCTTAATCTATCCGGCTCTCTATCACCAACCAAGCTCCAGAACCTCGAGCATCTTACGAGTTTGGTCCT...

CDS

Download CDS FASTA

2112 bp · TkA01G510630|TK1151|CDS

ATGTTATCGATCACTGTCCTTGTTGATTCAATAAACGAAGAAGGTGCTGTCCTTTTGGAGTTCAGATTCTCTCTTTCTGACCCAAATAACAATCTCCGTACATGGAATAATCAATCCGATTCATTTCCTTGTAATTGGATTGGTATAAACTGTACCATTGATCAGAAGGTAACGTCTATAAACCTCAGTAACCTTAATCTATCCGGCTCTCTATCACCAACCAAGCTCCAGAACCTCGAGCATCTTACGAGTTTGGTCCT...

Protein

Download Protein FASTA

703 aa · TkA01G510630|TK1151|PROTEIN

MLSITVLVDSINEEGAVLLEFRFSLSDPNNNLRTWNNQSDSFPCNWIGINCTIDQKVTSINLSNLNLSGSLSPTKLQNLEHLTSLVLWQNVLSGEIPPEIGNFSRLELLALHANSFTGSIPKEIGKLTELMRLYLYTNHLNGSIPEELGNCMKLVEIDLSENRLSGGIPKELGNIKNLRLLHLFENLLVGGIPKELSDLKELRKIDLSINNLTGAIPFEIGQLQNLKRLHLSDNYFFGHIPSEIGNLSQLVTFNVSSNRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G510630`
TK1151 ID	TkA01G510630
OH-1004 ID	LXL04_001783
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 38.691 / OH-1004 24.440 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G510630

Location Chr01:127941407-127944295 (+)

Description Similar to At1g17230: Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release
`At4g20270`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and CLV1, participates in the detection of CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At3g49670`	LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001783 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0038023 signaling receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G17230

ath:AT1G34110

ath:AT2G33170

ath:AT5G48940

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.804

Rank 1 · TkA01G510630 · TK1151

Endoplasmic reticulum0.107

Rank 2 · TkA01G510630 · TK1151

Cytoplasm0.070

Rank 3 · TkA01G510630 · TK1151

Lysosome / Vacuole0.049

Rank 4 · TkA01G510630 · TK1151

Nucleus0.039

Rank 5 · TkA01G510630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_212-52 aa

PF13855LRR_856-115 aa

PF12799LRR_456-90 aa

PF23211LRR_LRWD156-116 aa

PF25013LRR_Zer-156-112 aa

PF24048LRR_NXF1-556-94 aa

PF00560LRR_157-73 aa

PF23598LRR_1461-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G510630	`PF08263`	LRRNT_2	12	52	1.6e-10	41.8
TkA01G510630	`PF13855`	LRR_8	56	115	1.3e-20	73.6
TkA01G510630	`PF12799`	LRR_4	56	90	2.4e-12	47.4
TkA01G510630	`PF23211`	LRR_LRWD1	56	116	0.0003	21.3
TkA01G510630	`PF25013`	LRR_Zer-1	56	112	0.0017	19.2
TkA01G510630	`PF24048`	LRR_NXF1-5	56	94	5.6	7.3
TkA01G510630	`PF00560`	LRR_1	57	73	2e-35	113.8
TkA01G510630	`PF23598`	LRR_14	61	183	6.5e-30	104.8
TkA01G510630	`PF17795`	Vault_3	76	87	0.15	12.9
TkA01G510630	`PF24758`	LRR_At5g56370	80	138	0.21	12.0
TkA01G510630	`PF00560`	LRR_1	81	103	2e-35	113.8
TkA01G510630	`PF29252`	LRR_NLRC4	102	141	0.0042	17.1
TkA01G510630	`PF13855`	LRR_8	105	164	1.3e-20	73.6
TkA01G510630	`PF12799`	LRR_4	105	144	2.4e-12	47.4
TkA01G510630	`PF00560`	LRR_1	106	127	2e-35	113.8
TkA01G510630	`PF23286`	LRR_13	118	172	0.018	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHI2`	Arabidopsis thaliana	sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	55.300%	Swiss-Prot	Low
`Q9LVP0`	Arabidopsis thaliana	sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930	47.300%	Swiss-Prot	Low
`O49318`	Arabidopsis thaliana	sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170	46.400%	Swiss-Prot	Low
`O65440`	Arabidopsis thaliana	sp\|O65440\|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	43.400%	Swiss-Prot	Low
`Q9M2Z1`	Arabidopsis thaliana	sp\|Q9M2Z1\|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	40.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card