TkA01G509320 | RubberDandelionOmics

Gene overview

TkA01G509320

Reference: TK1151 Chr: Chr01 Coordinates: 127593988-127595736 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1545 bp · TkA01G509320|TK1151|cDNA

ATGGCGACTGCTTCAACTTCTTCTAGCACCCTATGGTGCAACCCCAGAACCACCACATTCTCATCCTCTCCTAAACTCCCTTCTCATTTTCCAATTTCTTCCGGAAAGAAACTGAATAAAATCAGCTGTGCTCTTCAATCACCTTCCATTCTCCAATTCCCCAAACAATCTCCCTTCCAATTACCTTCTTCGACCCCGAATTCATGGAACTTGTTGCAGAAAATTTCAGCCGTGGCATTGGATGCAGTCGAAAACGGTTT...

CDS

Download CDS FASTA

1545 bp · TkA01G509320|TK1151|CDS

ATGGCGACTGCTTCAACTTCTTCTAGCACCCTATGGTGCAACCCCAGAACCACCACATTCTCATCCTCTCCTAAACTCCCTTCTCATTTTCCAATTTCTTCCGGAAAGAAACTGAATAAAATCAGCTGTGCTCTTCAATCACCTTCCATTCTCCAATTCCCCAAACAATCTCCCTTCCAATTACCTTCTTCGACCCCGAATTCATGGAACTTGTTGCAGAAAATTTCAGCCGTGGCATTGGATGCAGTCGAAAACGGTTT...

Protein

Download Protein FASTA

514 aa · TkA01G509320|TK1151|PROTEIN

MATASTSSSTLWCNPRTTTFSSSPKLPSHFPISSGKKLNKISCALQSPSILQFPKQSPFQLPSSTPNSWNLLQKISAVALDAVENGLLQREKKNPLPKTADPSIQIAGNFSPVPEQSVRHCLPVVGEIPEHIQGVYLRNGANPLFEPTSGHHLFDGDGIGVANAGLVYFNNRLLAMSEDDLPYEVRVTPTGDLKTVGRYNFDEQLDSTMIAHPKLDPVSGELFALSYDVIQKPYLKYFRFSPDGTKSKDVAIDLGKPTMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G509320`
TK1151 ID	TkA01G509320
OH-1004 ID	LXL04_001800
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G509320

Location Chr01:127593988-127595736 (+)

Description Similar to NCED1: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14440`	May catalyze 11,12 (11′,12′) cleavage of 9-cis-epoxycarotenoids.	Regulation of drought tolerance by gene manipulation of 9-cis-epoxycarotenoid dioxygenase, a key enzyme in abscisic acid biosynthesis in Arabidopsis.2001 · DOI: 10.1046/j.1365-313x.2001.01096.x Uncoupling the effects of abscisic acid on plant growth and water relations. Analysis of sto1/nced3, an abscisic acid-deficient but salt stress-tolerant mutant in Arabidopsis.2004 · DOI: 10.1104/pp.104.046169
`At1g30100`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001800 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009856 pollination Biological Process

KEGG gene cross-reference

ag:AAF26356

ath:AT1G30100

ath:AT3G14440

sly:100316877

sly:544163

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · TkA01G509320 · TK1151

Cytoplasm0.039

Rank 2 · TkA01G509320 · TK1151

Mitochondrion0.034

Rank 3 · TkA01G509320 · TK1151

Peroxisome0.029

Rank 4 · TkA01G509320 · TK1151

Cell membrane0.024

Rank 5 · TkA01G509320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055RPE65112-158 aa

PF03055RPE65160-506 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G509320	`PF03055`	RPE65	112	158	5.7e-112	375.9
TkA01G509320	`PF03055`	RPE65	160	506	5.7e-112	375.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRR7`	Arabidopsis thaliana	sp\|Q9LRR7\|NCED3_ARATH 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic	65.100%	Swiss-Prot	High
`Q9C6Z1`	Arabidopsis thaliana	sp\|Q9C6Z1\|NCED5_ARATH Probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic	60.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card