TkA01G508400 | RubberDandelionOmics

Gene overview

TkA01G508400

Reference: TK1151 Chr: Chr01 Coordinates: 127339661-127342154 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1489 bp · TkA01G508400|TK1151|cDNA

TTTGAATCAATCCGACCTAACCGGAGTCCTGAACGGATTATATATACTAATTCGGATGAAACCTTCACAGACAGTATTATTCCATTTTATCATCAATCAAGAAATCTTAACGACAACAGACATACGTACGAACACTCCCACAGAATGTTCTGATCGTGTTCCCTAATTCTCCGTTTTCAATCTCTCGTACCCCTTCTCTGTATTCAACCTGCAACCATCATTTTCATCAGAGTTTCAACGAATTCAAGGATGCTAATGCC...

CDS

Download CDS FASTA

870 bp · TkA01G508400|TK1151|CDS

ATGGGGAATAAGCTTGTAATTAGAAAGAGGCATTCGGTGGACGAGAAGTACACAAAGCCTCAAGGGTTGTACGAACACAAGGATGTAGACCATAAAAAACTTCGTAAACTTATACTCGATTCTAAACTTGCTCCTTGTTATCCTGGTGATGATGACTCTAGCTGCGATCTTGAAGAATGCCCAATTTGCTTTTTGTATTATCCAAGTCTGAATCGTTCAAGATGTTGCATGAAAGTCATTTGTACAGAGTGTTTTCTACA...

Protein

Download Protein FASTA

289 aa · TkA01G508400|TK1151|PROTEIN

MGNKLVIRKRHSVDEKYTKPQGLYEHKDVDHKKLRKLILDSKLAPCYPGDDDSSCDLEECPICFLYYPSLNRSRCCMKVICTECFLQMKTPNSTRPTQCPFCKTFNYAVEYRGVKTKEEKGLEQIEEQLVIDAKIRMRRQEIQDEEERMQKRKDMSSSSRIIEGDEIVSIGGSGITNPTDSMHNRNDEFDLDNLMLMEAIWLSFQEDGSQHRNYGDAAELARYRTELHVSAAVGPPPETTSSASPYGGLACTIAREEGSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G508400`
TK1151 ID	TkA01G508400
OH-1004 ID	LXL04_001810
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G508400

Location Chr01:127339661-127342154 (-)

Description Similar to DA2: E3 ubiquitin-protein ligase DA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78420`	E3 ubiquitin-protein ligase involved in the regulation of organ and seed size.	No verified direct reference in this release
`At1g17145`	E3 ubiquitin-protein ligase involved in the regulation of organ and seed size.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A4GWX9`	E3 ubiquitin-protein ligase involved in the regulation of grain size.	No verified direct reference in this release
`Os02g0244100`	E3 ubiquitin-protein ligase involved in the regulation of grain size.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001810 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ago:AGOS_ADR255W

ath:AT1G17145

ath:AT1G78420

dosa:Os02g0244100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.625

Rank 1 · TkA01G508400 · TK1151

Nucleus0.323

Rank 2 · TkA01G508400 · TK1151

Cell membrane0.141

Rank 3 · TkA01G508400 · TK1151

Lysosome / Vacuole0.091

Rank 4 · TkA01G508400 · TK1151

Golgi apparatus0.075

Rank 5 · TkA01G508400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27641SIP5_N9-54 aa

PF27641SIP5_N57-160 aa

PF13920zf-C3HC4_358-104 aa

PF14634zf-RING_559-104 aa

PF13923zf-C3HC4_259-102 aa

PF26082zf-C2H2_AcuF59-72 aa

PF26082zf-C2H2_AcuF96-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G508400	`PF27641`	SIP5_N	9	54	3.2e-24	86.8
TkA01G508400	`PF27641`	SIP5_N	57	160	3.2e-24	86.8
TkA01G508400	`PF13920`	zf-C3HC4_3	58	104	0.0075	16.8
TkA01G508400	`PF14634`	zf-RING_5	59	104	0.34	11.6
TkA01G508400	`PF13923`	zf-C3HC4_2	59	102	3.9	8.1
TkA01G508400	`PF26082`	zf-C2H2_AcuF	59	72	5.1	7.6
TkA01G508400	`PF26082`	zf-C2H2_AcuF	96	104	5.1	7.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YV5`	Arabidopsis thaliana	sp\|Q93YV5\|DA2_ARATH E3 ubiquitin-protein ligase DA2	58.500%	Swiss-Prot	High
`Q940G8`	Arabidopsis thaliana	sp\|Q940G8\|DA2L_ARATH E3 ubiquitin-protein ligase DA2L	57.500%	Swiss-Prot	High
`A4GWX9`	Oryza sativa subsp. indica	sp\|A4GWX9\|GW2_ORYSI E3 ubiquitin-protein ligase GW2	53.300%	Swiss-Prot	High
`B9F4Q9`	Oryza sativa subsp. japonica	sp\|B9F4Q9\|GW2_ORYSJ E3 ubiquitin-protein ligase GW2	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card