TkA01G504850 | RubberDandelionOmics

Gene overview

TkA01G504850

Reference: TK1151 Chr: Chr01 Coordinates: 126418107-126424394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2434 bp · TkA01G504850|TK1151|cDNA

CTTCAGTCTTTCATCGTGAATGTTCCGATTTTGAACCAGTGCCACTCCCACGCTCCATCTCCTCGTCGCCGGTCGCCGGTCGATCGCCACTCCTCCCTGAACCGATTTCGACAGCCGCCTCTGCTCCTCCGCCTCTGCCAAATTGATTTGCTGCTGTGCGTCTCCTCGTTTCACTTCGTCATCCATCTCAGCATTTTCATGGTATCATATCTCTGTCTGTGATTTTGAGATAAAGTACTCCTAATTTTGCTCTATTTGAA...

CDS

Download CDS FASTA

1311 bp · TkA01G504850|TK1151|CDS

ATGTCTGTTACCCTTGATCTGTTAAAGGAATCATTGGAGTTCCATAAAAGATTATTTGAGGGTGTTGTTGATTCAGTACTGCATCAAGTCATCTTTGGTTTGTTTCTCTTCCTAGGATTTCTAGTCGCCAGAAACAACGCAGGGCTTATCAATATCAAAACTAAAGGCGCCAAGGGCGACGGCGTCGCCAATGATGCAGAAGCGATTATGACTGCATGGAAGGAGGCTTGCGATTCCCCAGTCCCATGTCAGGTGGCGAT...

Protein

Download Protein FASTA

436 aa · TkA01G504850|TK1151|PROTEIN

MSVTLDLLKESLEFHKRLFEGVVDSVLHQVIFGLFLFLGFLVARNNAGLINIKTKGAKGDGVANDAEAIMTAWKEACDSPVPCQVAIPPGTYMVSSPLTLSGPCKNPILMNANGATLKAPSDPTGIKGPGWIMFKNIEKMTLSGGIFDGQGQEAWKTNNAAKTGKCDLPFNFRFDMVKFSLIKGITSVNSKHFHMNFLGCDGTTVEKVTIEAPADSLNTDGIHIGRTNGLNISDCTIKTGDDCISIGDGSSNINVEKTKC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G504850`
TK1151 ID	TkA01G504850
OH-1004 ID	LXL04_001837
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 61.693 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G504850

Location Chr01:126418107-126424394 (+)

Description Similar to Exopolygalacturonase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07850`	May function in depolymerizing pectin during pollen development, germination, and tube growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001837 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004650 polygalacturonase activity Molecular Function

GO:0047911 galacturan 1,4-alpha-galacturonidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G07850

ghi:107942091

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.802

Rank 1 · TkA01G504850 · TK1151

Cell membrane0.077

Rank 2 · TkA01G504850 · TK1151

Cytoplasm0.062

Rank 3 · TkA01G504850 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA01G504850 · TK1151

Lysosome / Vacuole0.038

Rank 5 · TkA01G504850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim50-257 aa

PF00295Glyco_hydro_2877-406 aa

PF13229Beta_helix185-257 aa

PF05048NosD212-299 aa

PF13229Beta_helix221-294 aa

PF19627ADNP_N310-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G504850	`PF12708`	Pect-lyase_RHGA_epim	50	257	1.6e-15	58.2
TkA01G504850	`PF00295`	Glyco_hydro_28	77	406	1.9e-92	310.5
TkA01G504850	`PF13229`	Beta_helix	185	257	0.014	15.7
TkA01G504850	`PF05048`	NosD	212	299	0.14	12.3
TkA01G504850	`PF13229`	Beta_helix	221	294	0.014	15.7
TkA01G504850	`PF19627`	ADNP_N	310	349	0.29	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49063`	Arabidopsis thaliana	sp\|P49063\|PGLR2_ARATH Exopolygalacturonase	54.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card