RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G499490
Reference: TK1151 Chr: Chr01 Coordinates: 125137691-125139495 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1324 bp · TkA01G499490|TK1151|cDNA

CTAGGAACCCTCCTCTCTCAACTCTATCCCTCTTTGTTCTGATTCATTGCTTAAACCCTCTCCAATTCTCTTATCGGATGAAGATACAGTGTAATGTGTGTGAATCGGCGGAGGCGACGATGCTTTGTTGCGCCGATGAGGCGGCGTTGTGTTGGAATTGCGACGACAAGATACATGCTGCTAACAAGCTCGCGAGTAAACATCAGAGAATTCCTCTTTCTAATTCCAATAAGCAGATGCCTAAGTGCGATATATGCCAG...

CDS

Download CDS FASTA

540 bp · TkA01G499490|TK1151|CDS

ATGAAGATACAGTGTAATGTGTGTGAATCGGCGGAGGCGACGATGCTTTGTTGCGCCGATGAGGCGGCGTTGTGTTGGAATTGCGACGACAAGATACATGCTGCTAACAAGCTCGCGAGTAAACATCAGAGAATTCCTCTTTCTAATTCCAATAAGCAGATGCCTAAGTGCGATATATGCCAGGAATCAGATGGCTACTTCTTTTGTCTTGAAGACAGGGCATTACTGTGCCGCAAATGTGACGTCGCCATCCATACAGT...

Protein

Download Protein FASTA

179 aa · TkA01G499490|TK1151|PROTEIN

MKIQCNVCESAEATMLCCADEAALCWNCDDKIHAANKLASKHQRIPLSNSNKQMPKCDICQESDGYFFCLEDRALLCRKCDVAIHTVNSAVSSHQRFLLTGVKMGHETSDLVSSSSVKFPLTKKPHKHQNQFVSLLASQCQQTPNTTKFCPETFHLQSCLTVVVQQIASNNGSSMTFLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G499490
TK1151 IDTkA01G499490
OH-1004 IDLXL04_001908
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 67.039 / OH-1004 38.462
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G499490
LocationChr01:125137691-125139495 (+)
DescriptionSimilar to BBX22: B-box zinc finger protein 22
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g78600 Acts as a positive regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation, independently and in concert with HY5 and BBX21.
LZF1, a HY5-regulated transcriptional factor, functions in Arabidopsis de-etiolation.2008 · DOI: 10.1111/j.1365-313x.2008.03401.x
The common function of a novel subfamily of B-Box zinc finger proteins with reference to circadian-associated events in Arabidopsis thaliana.2008 · DOI: 10.1271/bbb.80041
LZF1/SALT TOLERANCE HOMOLOG3, an Arabidopsis B-box protein involved in light-dependent development and gene expression, undergoes COP1-mediated ubiquitination.2008 · DOI: 10.1105/tpc.108.061747
COP1-mediated degradation of BBX22/LZF1 optimizes seedling development in Arabidopsis.2011 · DOI: 10.1104/pp.111.175042
At1g06040 Acts as a negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation.
Nuclear localization and interaction with COP1 are required for STO/BBX24 function during photomorphogenesis.2011 · DOI: 10.1104/pp.111.180208
Arabidopsis STO/BBX24 negatively regulates UV-B signaling by interacting with COP1 and repressing HY5 transcriptional activity.2012 · DOI: 10.1038/cr.2012.34
The Arabidopsis B-BOX protein BBX25 interacts with HY5, negatively regulating BBX22 expression to suppress seedling photomorphogenesis.2013 · DOI: 10.1105/tpc.113.109751
At2g31380 Acts as a negative regulator of seedling photomorphogenesis.
The Arabidopsis B-BOX protein BBX25 interacts with HY5, negatively regulating BBX22 expression to suppress seedling photomorphogenesis.2013 · DOI: 10.1105/tpc.113.109751
At4g10240 Probable transcription factor that may be involved in seedling photomorphogenesis. No verified direct reference in this release
At4g39070 Acts as a positive regulator of seedling photomorphogenesis. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001908 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009641 shade avoidance Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process
GO:0010100 negative regulation of photomorphogenesis Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0015995 chlorophyll biosynthetic process Biological Process
GO:0048573 photoperiodism, flowering Biological Process
GO:0090351 seedling development Biological Process
KEGG gene cross-reference
ath:AT1G06040
ath:AT1G78600
ath:AT2G31380
ath:AT4G10240
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.580
Rank 1 · TkA01G499490 · TK1151
Cytoplasm0.450
Rank 2 · TkA01G499490 · TK1151
Cell membrane0.063
Rank 3 · TkA01G499490 · TK1151
Endoplasmic reticulum0.054
Rank 4 · TkA01G499490 · TK1151
Mitochondrion0.042
Rank 5 · TkA01G499490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00643zf-B_box3-47 aa
PF16366CEBP_ZZ4-43 aa
PF22586ANCHR-like_BBOX5-43 aa
PF10080FtrD-like5-35 aa
PF00628PHD5-34 aa
PF00643zf-B_box53-95 aa
PF10080FtrD-like55-86 aa
PF16366CEBP_ZZ56-95 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G499490PF00643zf-B_box3478.8e-1452.1
TkA01G499490PF16366CEBP_ZZ4430.01316.4
TkA01G499490PF22586ANCHR-like_BBOX5430.0001222.8
TkA01G499490PF10080FtrD-like5350.06114.2
TkA01G499490PF00628PHD5342.39.0
TkA01G499490PF00643zf-B_box53958.8e-1452.1
TkA01G499490PF10080FtrD-like55860.06114.2
TkA01G499490PF16366CEBP_ZZ56950.01316.4
TkA01G499490PF22586ANCHR-like_BBOX57950.0001222.8
TkA01G499490PF00628PHD57862.39.0
TkA01G499490PF00643zf-B_box1281428.8e-1452.1
TkA01G499490PF16366CEBP_ZZ1371530.01316.4
TkA01G499490PF00628PHD1501652.39.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SYM2Arabidopsis thalianasp|Q9SYM2|BBX22_ARATH B-box zinc finger protein 2276.500%Swiss-ProtMedium
Q96288Arabidopsis thalianasp|Q96288|BBX24_ARATH B-box zinc finger protein 2450.300%Swiss-ProtHigh
Q9SID1Arabidopsis thalianasp|Q9SID1|BBX25_ARATH B-box zinc finger protein 2552.700%Swiss-ProtHigh
O82617Arabidopsis thalianasp|O82617|BBX23_ARATH B-box zinc finger protein 2354.400%Swiss-ProtMedium
Q0IGM7Arabidopsis thalianasp|Q0IGM7|BBX20_ARATH B-box zinc finger protein 2052.100%Swiss-ProtMedium

JBrowse

View in Genome Browser