Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3308 bp · TkA01G497630|TK1151|cDNA
ATGGTCAGATCCCTGAGCACGCTCTTCTCGCCTTCACCATTGGTATGGATGCTACCACCCCCCAAATACTCCAAGTCCAGGTACGAGGAAATCGTGAAGGAAGTCTCATCTTACTTGAAGCCATTGAGTAACATGGAGGAGATGGTACAAGGGTATGGTCGGTGCTTGAAGCAGGAGAGTCTGCAGACCTTAGCTTGGCTTGGCCACCCTGAAGTCAGATTCACATTTGATCACATAGTTAGCGAGACAATAATCACAAT...
699 bp · TkA01G497630|TK1151|CDS
ATGGTCAGATCCCTGAGCACGCTCTTCTCGCCTTCACCATTGGTATGGATGCTACCACCCCCCAAATACTCCAAGTCCAGGTACGAGGAAATCGTGAAGGAAGTCTCATCTTACTTGAAGCCATTGAGTAACATGGAGGAGATGGTACAAGGGTATGGTCGGTGCTTGAAGCAGGAGAGTCTGCAGACCTTAGCTTGGCTTGGCCACCCTGAAGTCAGATTCACATTTGATCACATAGTTAGCGAGACAATAATCACAAT...
Protein
Download Protein FASTA232 aa · TkA01G497630|TK1151|PROTEIN
MVRSLSTLFSPSPLVWMLPPPKYSKSRYEEIVKEVSSYLKPLSNMEEMVQGYGRCLKQESLQTLAWLGHPEVRFTFDHIVSETIITISQEKLFRVAGLPMVDNCMSGYNSGMYAYGQWQKYTMMGEISQQDGKLVDDCGITPHLFEYLFTRIKLEEENRRDERLKYSCKCSFLEIYNEKITNLLEPSSTNLQVTEDSNEGVYVENLTEYNVKTVDEVLKLLLQESGGNRYEQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G497630 |
|---|---|
| TK1151 ID | TkA01G497630 |
| OH-1004 ID | LXL04_001930 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 96.100 |
| Protein coverage (%) | TK1151 87.500 / OH-1004 16.903Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G497630 | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:124549298-124571362 (+) | |||||||||||||||||||||
| Description | Similar to KIN12C: Kinesin-like protein KIN-12C | |||||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||||||||
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0000911 cytokinesis by cell plate formation Biological Process GO:0006412 translation Biological Process GO:0006414 translational elongation Biological Process GO:0007018 microtubule-based movement Biological Process GO:0005737 cytoplasm Cellular Component GO:0005874 microtubule Cellular Component GO:0009524 phragmoplast Cellular Component GO:0032153 cell division site Cellular Component GO:0003729 mRNA binding Molecular Function GO:0003746 translation elongation factor activity Molecular Function GO:0003777 microtubule motor activity Molecular Function | |||||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G17360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00225Kinesin60-223 aaPF16796Microtub_bd69-184 aaPF22736NNH5177-224 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G497630 | PF00225 | Kinesin | 60 | 223 | 9.1e-32 | 111.0 |
| TkA01G497630 | PF16796 | Microtub_bd | 69 | 184 | 2.1e-08 | 35.0 |
| TkA01G497630 | PF22736 | NNH5 | 177 | 224 | 0.13 | 12.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q27IK7 | Arabidopsis thaliana | sp|Q27IK7|KN12C_ARATH Kinesin-like protein KIN-12C | 71.800% | Swiss-Prot | High |
Q27IK6 | Arabidopsis thaliana | sp|Q27IK6|KN12D_ARATH Kinesin-like protein KIN-12D | 59.800% | Swiss-Prot | High |
B9GE13 | Oryza sativa subsp. japonica | sp|B9GE13|KN12F_ORYSJ Kinesin-like protein KIN-12F | 58.200% | Swiss-Prot | High |
B9FUF9 | Oryza sativa subsp. japonica | sp|B9FUF9|KN12E_ORYSJ Kinesin-like protein KIN-12E | 56.800% | Swiss-Prot | High |
Q75LL2 | Oryza sativa subsp. japonica | sp|Q75LL2|KN12G_ORYSJ Kinesin-like protein KIN-12G | 48.600% | Swiss-Prot | Medium |