TkA01G496890 | RubberDandelionOmics

Gene overview

TkA01G496890

Reference: TK1151 Chr: Chr01 Coordinates: 124357089-124363216 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

736 bp · TkA01G496890|TK1151|cDNA

TTTAAGTATACTTCTAAATGGACCCGTGCAAAGCACGGGTTGAATGCTAGTTAGAAAAAAAAGGCTGTCTCCCAAATTGGAACACACCCAAACCCGTAAAACCCTTTCACCTCTTTCGCTCATCTTCCCGCTCACCCTCCGCTCATCTTCCCGCTCTCCCTCCGGTCATCTTCCCGCTCGCCCTCCGTCACCCTCCTGTTCACCCAAATCGATCCCTCTCGGCGACTCAAGAACTAAACGCAGCAAGCATCTCGTCGGCT...

CDS

Download CDS FASTA

468 bp · TkA01G496890|TK1151|CDS

ATGCTAGTTAGAAAAAAAAGGCTGTCTCCCAAATTGGAACACACCCAAACCCGTAAAACCCTTTCACCTCTTTCGCTCATCTTCCCGCTCACCCTCCGCTCATCTTCCCGCTCTCCCTCCGGTCATCTTCCCGCTCGCCCTCCGTCACCCTCCTGTTCACCCAAATCGATCCCTCTCGGCGACTCAAGAACTAAACGCAGCAAGCATCTCGTCGGCTCTGGCAAATCGATCCCGCCCTCACCACTCGCTGTTGGTTTCTG...

Protein

Download Protein FASTA

155 aa · TkA01G496890|TK1151|PROTEIN

MLVRKKRLSPKLEHTQTRKTLSPLSLIFPLTLRSSSRSPSGHLPARPPSPSCSPKSIPLGDSRTKRSKHLVGSGKSIPPSPLAVGFCNQMPAMELDSGDRDKELFVEVDPSGRYGRYSELLGSGVVKKVYRAFDQEEGIEVAWNQVKLRNFCHKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G496890`
TK1151 ID	TkA01G496890
OH-1004 ID	LXL04_009771
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 53.548 / OH-1004 27.036 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G496890

Location Chr01:124357089-124363216 (-)

Description Similar to PHOS34: Universal stress protein PHOS34

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55560`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g22420`	Regulates flowering time by modulating the photoperiod pathway.	The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g04910`	Regulates flowering time by modulating the photoperiod pathway.	The APRR3 component of the clock-associated APRR1/TOC1 quintet is phosphorylated by a novel protein kinase belonging to the WNK family, the gene for which is also transcribed rhythmically in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf084 Compilation and characterization of a novel WNK family of protein kinases in Arabiodpsis thaliana with reference to circadian rhythms.2002 · DOI: 10.1271/bbb.66.2429 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0584100`	Probable serine/threonine-protein kinase WNK5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009771 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0003824 catalytic activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G27320

ath:AT5G54430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.486

Rank 1 · TkA01G496890 · TK1151

Cytoplasm0.387

Rank 2 · TkA01G496890 · TK1151

Cell membrane0.129

Rank 3 · TkA01G496890 · TK1151

Endoplasmic reticulum0.089

Rank 4 · TkA01G496890 · TK1151

Plastid0.080

Rank 5 · TkA01G496890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23395SAM_6104-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G496890	`PF23395`	SAM_6	104	132	0.23	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ICW6`	Arabidopsis thaliana	sp\|Q6ICW6\|WNK11_ARATH Probable serine/threonine-protein kinase WNK11	86.800%	Swiss-Prot	Low
`Q8S8Y9`	Arabidopsis thaliana	sp\|Q8S8Y9\|WNK2_ARATH Serine/threonine-protein kinase WNK2	76.500%	Swiss-Prot	Low
`Q9STK6`	Arabidopsis thaliana	sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3	65.600%	Swiss-Prot	Low
`Q9CAV6`	Arabidopsis thaliana	sp\|Q9CAV6\|WNK1_ARATH Serine/threonine-protein kinase WNK1	72.500%	Swiss-Prot	Low
`Q0D541`	Oryza sativa subsp. japonica	sp\|Q0D541\|WNK5_ORYSJ Probable serine/threonine-protein kinase WNK5	74.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card