TkA01G494130 | RubberDandelionOmics

Gene overview

TkA01G494130

Reference: TK1151 Chr: Chr01 Coordinates: 123637392-123638039 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA01G494130|TK1151|cDNA

ATGAACCAGATAAACATCAAACCTGATCCAATCATATTCGGAACTCTACTCGATTCATGCACCCTCCACAAAAACATCGAATCAGCAGAAAAAATCGCAAACTCTTTAATCAATCAAAACCTCGCGTATTCCGGAACGTACATCCTTCTGTCAAACCTATACGCCGCGACTTCAAATTGGGCCCGAGTGGCCCACATGAGAACACTGATGAAAACCCACGACGTAGAAAAAGAACCCGGGTGTAGCTCCATTGAGATCGA...

CDS

Download CDS FASTA

648 bp · TkA01G494130|TK1151|CDS

ATGAACCAGATAAACATCAAACCTGATCCAATCATATTCGGAACTCTACTCGATTCATGCACCCTCCACAAAAACATCGAATCAGCAGAAAAAATCGCAAACTCTTTAATCAATCAAAACCTCGCGTATTCCGGAACGTACATCCTTCTGTCAAACCTATACGCCGCGACTTCAAATTGGGCCCGAGTGGCCCACATGAGAACACTGATGAAAACCCACGACGTAGAAAAAGAACCCGGGTGTAGCTCCATTGAGATCGA...

Protein

Download Protein FASTA

215 aa · TkA01G494130|TK1151|PROTEIN

MNQINIKPDPIIFGTLLDSCTLHKNIESAEKIANSLINQNLAYSGTYILLSNLYAATSNWARVAHMRTLMKTHDVEKEPGCSSIEIDNKVHEFVAGDMNHPKSAEIYEMVAEVNGWLVGHGYRPQTEVVVQDIGEKERVRSLEVHSEKLAIAFGLISTKAGSGSSIKIVKNLRVCLDCHEVTKLISKVTGRRIVVRDRNRFHHFVDGVCSCGDYW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G494130`
TK1151 ID	TkA01G494130
OH-1004 ID	LXL04_001962
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 33.863 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G494130

Location Chr01:123637392-123638039 (-)

Description Similar to ELI1: Pentatricopeptide repeat-containing protein ELI1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37380`	Plays a major role in single RNA editing events in chloroplasts.	No verified direct reference in this release
`At1g08070`	Involved in multiple sites RNA editing events in chloroplasts.	No verified direct reference in this release
`At5g48910`	Pentatricopeptide repeat-containing protein At5g48910.	No verified direct reference in this release
`At3g26782`	Pentatricopeptide repeat-containing protein At3g26782, mitochondrial.	No verified direct reference in this release
`At5g06540`	Pentatricopeptide repeat-containing protein At5g06540.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001962 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G29760

ath:AT4G37380

ath:AT5G48910

ath:AT5G66520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.374

Rank 1 · TkA01G494130 · TK1151

Nucleus0.278

Rank 2 · TkA01G494130 · TK1151

Plastid0.157

Rank 3 · TkA01G494130 · TK1151

Cytoplasm0.136

Rank 4 · TkA01G494130 · TK1151

Peroxisome0.020

Rank 5 · TkA01G494130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20431E_motif23-85 aa

PF27626CNOT10_TPR24-56 aa

PF20430Eplus_motif90-109 aa

PF14432DYW_deaminase121-215 aa

PF16110DUF4828165-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G494130	`PF20431`	E_motif	23	85	7.5e-17	62.1
TkA01G494130	`PF27626`	CNOT10_TPR	24	56	0.14	12.6
TkA01G494130	`PF20430`	Eplus_motif	90	109	6.1e-09	36.2
TkA01G494130	`PF14432`	DYW_deaminase	121	215	1.1e-38	131.7
TkA01G494130	`PF16110`	DUF4828	165	202	0.23	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZT8`	Arabidopsis thaliana	sp\|Q9SZT8\|PP354_ARATH Pentatricopeptide repeat-containing protein ELI1, chloroplastic	55.300%	Swiss-Prot	High
`Q9LN01`	Arabidopsis thaliana	sp\|Q9LN01\|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070, chloroplastic	51.200%	Swiss-Prot	High
`Q9FI80`	Arabidopsis thaliana	sp\|Q9FI80\|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910	51.000%	Swiss-Prot	High
`Q9LW32`	Arabidopsis thaliana	sp\|Q9LW32\|PP258_ARATH Pentatricopeptide repeat-containing protein At3g26782, mitochondrial	47.900%	Swiss-Prot	Medium
`Q9FG16`	Arabidopsis thaliana	sp\|Q9FG16\|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card