TkA01G494070 | RubberDandelionOmics

Gene overview

TkA01G494070

Reference: TK1151 Chr: Chr01 Coordinates: 123630984-123631733 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · TkA01G494070|TK1151|cDNA

ATGCGTAGGCATAGCCATTCTTTGGGATTAGAGGAAAAAATATCTCATATAATATTATGGAACCCTGTGACCAACGACCACAAGAAGTTGCCTAAAGCCCGTTCTCGCCGTAGTTACATGACGAGTTTTCATAAATACGAGTTATATTACAGCTTTTCTGAGAATGACTACAAGCTTATATGGCTAAGCCACCGTCGTAATGTCCGTATATTTTCTCTAAAATCCAACAAATGGACAAAGATCAAGTCAAAAACCAAGCT...

CDS

Download CDS FASTA

750 bp · TkA01G494070|TK1151|CDS

ATGCGTAGGCATAGCCATTCTTTGGGATTAGAGGAAAAAATATCTCATATAATATTATGGAACCCTGTGACCAACGACCACAAGAAGTTGCCTAAAGCCCGTTCTCGCCGTAGTTACATGACGAGTTTTCATAAATACGAGTTATATTACAGCTTTTCTGAGAATGACTACAAGCTTATATGGCTAAGCCACCGTCGTAATGTCCGTATATTTTCTCTAAAATCCAACAAATGGACAAAGATCAAGTCAAAAACCAAGCT...

Protein

Download Protein FASTA

249 aa · TkA01G494070|TK1151|PROTEIN

MRRHSHSLGLEEKISHIILWNPVTNDHKKLPKARSRRSYMTSFHKYELYYSFSENDYKLIWLSHRRNVRIFSLKSNKWTKIKSKTKLSSSDTVSHHIMSSVMSNEKFHFLRKFFVFEGGDEKVCLGNDEKRDFMGFLDLKGRAYLCVALINSKGEYDVIELFRRVGGSQYYWNDYWERMTKENSSISDDHLHLMRNGNWLMYSSCKEYIYVLDMKKRTRGTMRPSNIAFHPGGKFIETLVSPNQYNDNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G494070`
TK1151 ID	TkA01G494070
OH-1004 ID	LXL04_001960
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 98.394 / OH-1004 68.820 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G494070`
Location	Chr01:123630984-123631733 (-)
Description	Similar to At1g47790: Putative F-box protein At1g47790
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001960` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT1G11620 ath:AT1G12870 ath:AT1G47790 ath:AT3G23880 ath:AT4G04690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · TkA01G494070 · TK1151

Cytoplasm0.365

Rank 2 · TkA01G494070 · TK1151

Cell membrane0.095

Rank 3 · TkA01G494070 · TK1151

Endoplasmic reticulum0.084

Rank 4 · TkA01G494070 · TK1151

Extracellular0.047

Rank 5 · TkA01G494070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_314-92 aa

PF03478Beta-prop_KIB1-415-111 aa

PF24814WD40_Prp1951-86 aa

PF03478Beta-prop_KIB1-4168-219 aa

PF24814WD40_Prp19212-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G494070	`PF08268`	FBA_3	14	92	0.00039	20.3
TkA01G494070	`PF03478`	Beta-prop_KIB1-4	15	111	7.2e-05	23.1
TkA01G494070	`PF24814`	WD40_Prp19	51	86	0.09	12.5
TkA01G494070	`PF03478`	Beta-prop_KIB1-4	168	219	7.2e-05	23.1
TkA01G494070	`PF24814`	WD40_Prp19	212	236	0.09	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card