TkA01G490210 | RubberDandelionOmics

Gene overview

TkA01G490210

Reference: TK1151 Chr: Chr01 Coordinates: 122676231-122678670 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1408 bp · TkA01G490210|TK1151|cDNA

CAGATTACTGATATCTTGTCATATTACAAGAATGGCTCAATTGGTGACATTCATTTTGTTCTTGCTAACATGCATGCTTTCATTCATCTCGTGTTCTACCGGTCTCACCAAAGTCAGCCTTGAATCCACCATTATATTTAACGTCTTGGCTTATGGTGCTAAAGGAAACGGGATAACCGATGACTCACCGGCTTTTACGAAGGCATGGAAAGCCGCGTGTAATTCGCAACCAAATAAAAGAAGTATATTAGTGATACCAG...

CDS

Download CDS FASTA

1239 bp · TkA01G490210|TK1151|CDS

ATGGCTCAATTGGTGACATTCATTTTGTTCTTGCTAACATGCATGCTTTCATTCATCTCGTGTTCTACCGGTCTCACCAAAGTCAGCCTTGAATCCACCATTATATTTAACGTCTTGGCTTATGGTGCTAAAGGAAACGGGATAACCGATGACTCACCGGCTTTTACGAAGGCATGGAAAGCCGCGTGTAATTCGCAACCAAATAAAAGAAGTATATTAGTGATACCAGGAGGGAGGACGTATTTTTTAAAGCCCATGGA...

Protein

Download Protein FASTA

412 aa · TkA01G490210|TK1151|PROTEIN

MAQLVTFILFLLTCMLSFISCSTGLTKVSLESTIIFNVLAYGAKGNGITDDSPAFTKAWKAACNSQPNKRSILVIPGGRTYFLKPMDFNGPCKPSSIYVQVSGNIVAPTKKTDWLGHHVDTWLSFNTVNGLTVSGNGRIDGRGSIWWTNDCIGSPPPGTPCHAPVALQFKKCNGLRLNGLTHVNSPRVHLLMTKCNGVIFSNLKIIAPETSPNTDGINIASSTNIKIRDSVIGTGDDCIAISGGSSNIKISGIMCGPGHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G490210`
TK1151 ID	TkA01G490210
OH-1004 ID	LXL04_032358
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.400
Protein coverage (%)	TK1151 91.019 / OH-1004 94.776 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G490210

Location Chr01:122676231-122678670 (-)

Description Similar to At3g15720: Probable polygalacturonase At3g15720

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15720`	Probable polygalacturonase At3g15720.	No verified direct reference in this release
`At1g80170`	Probable polygalacturonase At1g80170.	No verified direct reference in this release
`At2g41850`	Polygalacturonase involved in cell separation in the final stages of pod shatter, in anther dehiscence and in floral organ abscission.	Expression of polygalacturonases and evidence to support their role during cell separation processes in Arabidopsis thaliana.2007 · DOI: 10.1093/jxb/erm222 ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032358 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009830 cell wall modification involved in abscission Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G80170

ath:AT3G07970

ath:AT3G15720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.830

Rank 1 · TkA01G490210 · TK1151

Cytoplasm0.055

Rank 2 · TkA01G490210 · TK1151

Cell membrane0.045

Rank 3 · TkA01G490210 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA01G490210 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA01G490210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim35-82 aa

PF00295Glyco_hydro_2871-397 aa

PF12708Pect-lyase_RHGA_epim200-282 aa

PF12708Pect-lyase_RHGA_epim335-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G490210	`PF12708`	Pect-lyase_RHGA_epim	35	82	8.4e-07	29.7
TkA01G490210	`PF00295`	Glyco_hydro_28	71	397	6e-83	279.3
TkA01G490210	`PF12708`	Pect-lyase_RHGA_epim	200	282	8.4e-07	29.7
TkA01G490210	`PF12708`	Pect-lyase_RHGA_epim	335	357	8.4e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW07`	Arabidopsis thaliana	sp\|Q9LW07\|PGLR3_ARATH Probable polygalacturonase At3g15720	45.200%	Swiss-Prot	Medium
`Q94AJ5`	Arabidopsis thaliana	sp\|Q94AJ5\|PGLR5_ARATH Probable polygalacturonase At1g80170	41.800%	Swiss-Prot	Medium
`Q8RY29`	Arabidopsis thaliana	sp\|Q8RY29\|ADPG2_ARATH Polygalacturonase ADPG2	43.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card