TkA01G484320 | RubberDandelionOmics

Gene overview

TkA01G484320

Reference: TK1151 Chr: Chr01 Coordinates: 121222620-121224457 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · TkA01G484320|TK1151|cDNA

CTGCTTCTCTCAATTCTGTCATCGTCCCAGTAAATCGAAGGGGTTTTGGCCAAAATCAAGCACAGAGAATACGTTGAAGGTTCAATCTCTCATTCAAGTCACATCCCCTTCGATTCCTTTTCTTCTTCCTTAGACGGATCTAGCAGCGCCACCGCAACTTCTGGCACCGCTACTCCTTACACCTTCGTCTCAGTATTTGGTTGTTATCGACATTTGATTATGGCGAAACAGAATCTTTACGGCTTCTTTCTTTGCATGAC...

CDS

Download CDS FASTA

342 bp · TkA01G484320|TK1151|CDS

ATGGCGAAACAGAATCTTTACGGCTTCTTTCTTTGCATGACAACAAATATTTGCGCTACTTTAAAGGTTTTTTATAGGGCTGTCTTTCTTAGTCTATGTGCCCCAACAGATTGTTTCATTTTGGGCTCTCTTGATAGAATCATTATTCTTTGGGATCAAAATATTGATAAATGGCAGGGACATTTATGGGTGAAAGGAAAACCAGCTTCAGCTTATACTGATCAAGGACTTGTATTTGTAGTTGCTTTTGGAGGATCTAT...

Protein

Download Protein FASTA

113 aa · TkA01G484320|TK1151|PROTEIN

MAKQNLYGFFLCMTTNICATLKVFYRAVFLSLCAPTDCFILGSLDRIIILWDQNIDKWQGHLWVKGKPASAYTDQGLVFVVAFGGSIRMVDSCNYKNVCIYLMWRLLNSSFQV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G484320`
TK1151 ID	TkA01G484320
OH-1004 ID	LXL04_006111
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.200
Protein coverage (%)	TK1151 76.106 / OH-1004 27.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G484320

Location Chr01:121222620-121224457 (+)

Description Similar to APRF1: Protein ANTHESIS POMOTING FACTOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14530`	Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus (By similarity).	APRF1 promotes flowering under long days in Arabidopsis thaliana.2016 · DOI: 10.1016/j.plantsci.2016.09.015

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006111 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001111 RNA polymerase II promoter clearance Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0009908 flower development Biological Process

GO:0032785 negative regulation of DNA-templated transcription, elongation Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0071027 nuclear RNA surveillance Biological Process

GO:0110064 lncRNA catabolic process Biological Process

GO:0140744 negative regulation of lncRNA transcription Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G14530

dme:Dmel_CG17293

dre:321614

xla:735072

xtr:448141

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.410

Rank 1 · TkA01G484320 · TK1151

Cytoplasm0.406

Rank 2 · TkA01G484320 · TK1151

Mitochondrion0.114

Rank 3 · TkA01G484320 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA01G484320 · TK1151

Cell membrane0.061

Rank 5 · TkA01G484320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYK6`	Arabidopsis thaliana	sp\|Q9LYK6\|APRF1_ARATH Protein ANTHESIS PROMOTING FACTOR 1	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card