TkA01G484300 | RubberDandelionOmics

Gene overview

TkA01G484300

Reference: TK1151 Chr: Chr01 Coordinates: 121216044-121216693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkA01G484300|TK1151|cDNA

ATGGTGGTTCTTCGATCTTGCAAGTTTACTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATATTCCTCGACGAACGCACAAACCCCTTCAGTTCAGAATCATGATGCTCTGTATAAGCGAATCTCACCGTCCGCAATAACGCAAAAGACTTCTGTTGTTCCGATAATCGAGCAATGGGTGCAGGAAGGTAAATATATCGTAGTTGATGAGCTCAAAAGCACGATCAAAATATA...

CDS

Download CDS FASTA

447 bp · TkA01G484300|TK1151|CDS

ATGGTGGTTCTTCGATCTTGCAAGTTTACTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATATTCCTCGACGAACGCACAAACCCCTTCAGTTCAGAATCATGATGCTCTGTATAAGCGAATCTCACCGTCCGCAATAACGCAAAAGACTTCTGTTGTTCCGATAATCGAGCAATGGGTGCAGGAAGGTAAATATATCGTAGTTGATGAGCTCAAAAGCACGATCAAAATATA...

Protein

Download Protein FASTA

148 aa · TkA01G484300|TK1151|PROTEIN

MVVLRSCKFTDHTLSSNSNRISRIFFKNSYSSTNAQTPSVQNHDALYKRISPSAITQKTSVVPIIEQWVQEGKYIVVDELKSTIKIYRKHNRYSQALQLSEWMTNRSYLDQSSENLAIHLDLISRVHSLEQAEKFFDSILDSKKNFKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G484300`
TK1151 ID	TkA01G484300
OH-1004 ID	LXL04_002086
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 88.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G484300`
Location	Chr01:121216044-121216693 (-)
Description	Similar to At2g20710: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002086` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000963 mitochondrial RNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0032543 mitochondrial translation Biological Process GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005761 mitochondrial ribosome Cellular Component GO:0009507 chloroplast Cellular Component GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G02150 ath:AT2G20710 ath:AT3G15590 ath:AT4G02820 ath:AT4G21705 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.837

Rank 1 · TkA01G484300 · TK1151

Plastid0.060

Rank 2 · TkA01G484300 · TK1151

Nucleus0.045

Rank 3 · TkA01G484300 · TK1151

Cytoplasm0.038

Rank 4 · TkA01G484300 · TK1151

Cell membrane0.008

Rank 5 · TkA01G484300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28771RMD9_mid13-34 aa

PF09533DUF238065-129 aa

PF28771RMD9_mid77-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G484300	`PF28771`	RMD9_mid	13	34	0.0018	18.8
TkA01G484300	`PF09533`	DUF2380	65	129	0.075	13.2
TkA01G484300	`PF28771`	RMD9_mid	77	145	0.0018	18.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card