TkA01G483430 | RubberDandelionOmics

Gene overview

TkA01G483430

Reference: TK1151 Chr: Chr01 Coordinates: 121015700-121016837 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

920 bp · TkA01G483430|TK1151|cDNA

ATCAGGAGGAGATAAGCCTACCATAAATGGGTGGATACCATACCTCTCCCTACAAACCCATTTTTCCACATGGCGTCCTCCGATCCATGCAACTGCATCCAGACGACCCCACCACACCCTCTTCTGATTCTCGCTCGTTATTCCATATACTCTCATCCATCAGTTCGATCGACGATAAATCTAATCACATTTACTCCAACAAGCACAGGTTGTAAGCTTCTGTTGTTTGGCAACAATGGCGTCTCTTGCAACCTTCGCAC...

CDS

Download CDS FASTA

426 bp · TkA01G483430|TK1151|CDS

ATGGCGTCTCTTGCAACCTTCGCACCAACCACCGTTAACGGCCTTGCTGGCAGTTCCCTCACCGGAACCAAGCTTAACGTCAGGCCTTCTCGCCTCGCTCTCAAACCCAAATCTCACAGATCTGGGGCTGTTGTAGCTAAATACGGAGACAAAAGTGTGTACTTCGATTTGGAAGATTTGGGCAACACCACCGGTCAGTGGGATGTTTACGGTTCAGATGCCCCTTCACCATACAATCCCCTCCAGAGCAAGTTCTTCGA...

Protein

Download Protein FASTA

141 aa · TkA01G483430|TK1151|PROTEIN

MASLATFAPTTVNGLAGSSLTGTKLNVRPSRLALKPKSHRSGAVVAKYGDKSVYFDLEDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSSTATGDVLPIVKGPQLPPKLGPRGKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483430`
TK1151 ID	TkA01G483430
OH-1004 ID	LXL04_002101
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483430

Location Chr01:121015700-121016837 (+)

Description Similar to PSAH1: Photosystem I reaction center subunit VI-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16140`	Possible role could be the docking of the LHC I antenna complex to the core complex.	No verified direct reference in this release
`At1g52230`	Possible role could be the docking of the LHC I antenna complex to the core complex.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y7D9`	Possible role could be the docking of the LHC I antenna complex to the core complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002101 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009538 photosystem I reaction center Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0060090 molecular adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G52230

ath:AT3G16140

brp:103871224

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkA01G483430 · TK1151

Mitochondrion0.016

Rank 2 · TkA01G483430 · TK1151

Cytoplasm0.009

Rank 3 · TkA01G483430 · TK1151

Nucleus0.007

Rank 4 · TkA01G483430 · TK1151

Cell membrane0.007

Rank 5 · TkA01G483430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03244PSI_PsaH6-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483430	`PF03244`	PSI_PsaH	6	141	3.4e-70	234.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUI7`	Arabidopsis thaliana	sp\|Q9SUI7\|PSAH1_ARATH Photosystem I reaction center subunit VI-1, chloroplastic	77.900%	Swiss-Prot	High
`Q9SUI6`	Arabidopsis thaliana	sp\|Q9SUI6\|PSAH2_ARATH Photosystem I reaction center subunit VI-2, chloroplastic	77.900%	Swiss-Prot	High
`A2Y7D9`	Oryza sativa subsp. indica	sp\|A2Y7D9\|PSAH_ORYSI Photosystem I reaction center subunit VI, chloroplastic	73.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card