TkA01G482740 | RubberDandelionOmics

Gene overview

TkA01G482740

Reference: TK1151 Chr: Chr01 Coordinates: 120852338-120859012 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2042 bp · TkA01G482740|TK1151|cDNA

TTTGCAGCAGCCCATTTAATTGGAGTCCTATCCAGTTACTTCCCAAGTCGATCCCCACCTTTGCTTTAACGCTTTTTCCTCCTCCCCTTTTCTCACCTCCGATCACACTCCCAATCATACCAACAACAATTCCTCACTGCAAATTCACTACATTCCAATCAACAAATCATTGTGTCAGTCCCATCTATGGAAATTTTATCGTCCAGCGACGAATCCGATCACCGGAGCCAGAGGTTTGAGGATTATAGCGTCAGTGCCGA...

CDS

Download CDS FASTA

1146 bp · TkA01G482740|TK1151|CDS

ATGATGGAGGGGCTTAAGCTTTTTGATCTACTGGATGTCCGCATCCCAACGCACTCGCCCCCAATCTCGCCAGTTTCAGTTTCATACAAAAAAATCCAGACGATGAGAGAAACCCTAGCATCAACCTCATCATCCGCAACATCCGACAGCACTCCACCAATCGAAACAGCTTGGATTAATGCTCACGAAAGATTATCACCTCGTTGGCAATCCTCAGCTCTTTCGCCCCAGTCTTCAATTCCAATCGCAATATCCCGAGT...

Protein

Download Protein FASTA

381 aa · TkA01G482740|TK1151|PROTEIN

MMEGLKLFDLLDVRIPTHSPPISPVSVSYKKIQTMRETLASTSSSATSDSTPPIETAWINAHERLSPRWQSSALSPQSSIPIAISRVNQVDAGRLDIEMSAMLKEQMVKVFSVMKPGLLFQYEAELDAFLEFLIWRFSIWVDKPTPGNALMNLRYRDERTMDTRAKIRTGLEGPGLTVYQKIWYCIATVGGQYIWTRLQSFSAFRQWGDSDQRSLARRIWFIVQRIEGFYKAASFTNLLIFLYTGRYRNLIERLIKARLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G482740`
TK1151 ID	TkA01G482740
OH-1004 ID	LXL04_002106
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 97.375 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G482740

Location Chr01:120852338-120859012 (+)

Description Similar to PEX2: Peroxisome biogenesis protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79810`	E3 ubiquitin-protein ligase component of a retrotranslocation channel required for peroxisome organization by mediating export of the PEX5 receptor from peroxisomes to the cytosol, thereby promoting PEX5 recycling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002106 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0000425 pexophagy Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016562 protein import into peroxisome matrix, receptor recycling Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031648 protein destabilization Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0042632 cholesterol homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G79810

ddi:DDB_G0272234

mmu:19302

rno:29534

xla:108719303

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.827

Rank 1 · TkA01G482740 · TK1151

Mitochondrion0.142

Rank 2 · TkA01G482740 · TK1151

Nucleus0.069

Rank 3 · TkA01G482740 · TK1151

Cytoplasm0.060

Rank 4 · TkA01G482740 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA01G482740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04757Pex2_Pex1297-307 aa

PF00104Hormone_recep195-240 aa

PF13920zf-C3HC4_3319-366 aa

PF13639zf-RING_2321-362 aa

PF00097zf-C3HC4322-362 aa

PF13445zf-RING_UBOX322-359 aa

PF13923zf-C3HC4_2322-353 aa

PF14634zf-RING_5322-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G482740	`PF04757`	Pex2_Pex12	97	307	1.1e-39	137.1
TkA01G482740	`PF00104`	Hormone_recep	195	240	0.15	12.2
TkA01G482740	`PF13920`	zf-C3HC4_3	319	366	0.00036	21.0
TkA01G482740	`PF13639`	zf-RING_2	321	362	0.025	15.6
TkA01G482740	`PF00097`	zf-C3HC4	322	362	0.00012	22.5
TkA01G482740	`PF13445`	zf-RING_UBOX	322	359	0.0077	16.9
TkA01G482740	`PF13923`	zf-C3HC4_2	322	353	0.049	14.2
TkA01G482740	`PF14634`	zf-RING_5	322	363	2.4	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA86`	Arabidopsis thaliana	sp\|Q9CA86\|PEX2_ARATH Peroxisome biogenesis protein 2	74.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card