TkA01G477520 | RubberDandelionOmics

Gene overview

TkA01G477520

Reference: TK1151 Chr: Chr01 Coordinates: 119608106-119611311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1812 bp · TkA01G477520|TK1151|cDNA

ATGAAGTTTCATCCCATCCTCCTTCTGTTATTCTCCATTACCACCATATTTCTTCTCTTGTCAAGCTGTTCTGCAGTAAACACCATATTCGCAAATCAAAGGATTAAAGATGGCGAAACCCTCGTTTCAAATGGTAAGATGTATGAATTGGGGTTTTTTAGCCCGGGAAAATCCAAAAATCGCTACGTCGGAATATGGTACAAACAGATATCAACGTTCACGGTTGTAGTCACGAATGCTAAACCAGTGGTAAATCCAGT...

CDS

Download CDS FASTA

1641 bp · TkA01G477520|TK1151|CDS

ATGAAGTTTCATCCCATCCTCCTTCTGTTATTCTCCATTACCACCATATTTCTTCTCTTGTCAAGCTGTTCTGCAGTAAACACCATATTCGCAAATCAAAGGATTAAAGATGGCGAAACCCTCGTTTCAAATGGTAAGATGTATGAATTGGGGTTTTTTAGCCCGGGAAAATCCAAAAATCGCTACGTCGGAATATGGTACAAACAGATATCAACGTTCACGGTTGTAGTCACGAATGCTAAACCAGTGGTAAATCCAGT...

Protein

Download Protein FASTA

546 aa · TkA01G477520|TK1151|PROTEIN

MKFHPILLLLFSITTIFLLLSSCSAVNTIFANQRIKDGETLVSNGKMYELGFFSPGKSKNRYVGIWYKQISTFTVVVTNAKPVVNPVAQLLDSGNLVVWDEISLKESPIWQSFDYPGNTMLPGMKMGKDLFVVNEKEIYFRYTYKSSLAQRVILTSDGIQTLTNWIERTKEWIVFANVVVDSCSRYGHCGPYGSCSIKIYPPCSCMEGFEPRVPEEWNAGDWSSGCQRKRPLGCGTRDGFKKISGVKFPDTRGVLDDGKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G477520`
TK1151 ID	TkA01G477520
OH-1004 ID	LXL04_012531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.400
Protein coverage (%)	TK1151 95.604 / OH-1004 51.819 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G477520

Location Chr01:119608106-119611311 (+)

Description Similar to At4g27290: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1.	No verified direct reference in this release
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G21380

ath:AT4G27290

ath:AT4G27300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.819

Rank 1 · TkA01G477520 · TK1151

Cytoplasm0.102

Rank 2 · TkA01G477520 · TK1151

Endoplasmic reticulum0.078

Rank 3 · TkA01G477520 · TK1151

Nucleus0.059

Rank 4 · TkA01G477520 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA01G477520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin77-130 aa

PF00954S_locus_glycop109-212 aa

PF00954S_locus_glycop225-241 aa

PF00069Pkinase256-438 aa

PF07714PK_Tyr_Ser-Thr259-504 aa

PF12330Haspin_kinase330-385 aa

PF03109ABC1347-386 aa

PF01636APH350-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G477520	`PF01453`	B_lectin	77	130	6.8e-14	52.9
TkA01G477520	`PF00954`	S_locus_glycop	109	212	1e-20	75.0
TkA01G477520	`PF00954`	S_locus_glycop	225	241	1e-20	75.0
TkA01G477520	`PF00069`	Pkinase	256	438	1.1e-39	137.1
TkA01G477520	`PF07714`	PK_Tyr_Ser-Thr	259	504	3.6e-43	148.4
TkA01G477520	`PF12330`	Haspin_kinase	330	385	0.0063	16.3
TkA01G477520	`PF03109`	ABC1	347	386	0.024	14.5
TkA01G477520	`PF01636`	APH	350	382	0.042	14.3
TkA01G477520	`PF11883`	DUF3403	510	525	0.015	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81833`	Arabidopsis thaliana	sp\|O81833\|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	63.800%	Swiss-Prot	Medium
`O81832`	Arabidopsis thaliana	sp\|O81832\|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	61.700%	Swiss-Prot	Medium
`Q9ZR08`	Arabidopsis thaliana	sp\|Q9ZR08\|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	59.600%	Swiss-Prot	Medium
`O81906`	Arabidopsis thaliana	sp\|O81906\|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120	58.000%	Swiss-Prot	Medium
`Q9S972`	Arabidopsis thaliana	sp\|Q9S972\|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6	58.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card