TkA01G475170 | RubberDandelionOmics

Gene overview

TkA01G475170

Reference: TK1151 Chr: Chr01 Coordinates: 118954097-118955737 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1605 bp · TkA01G475170|TK1151|cDNA

ATGATCAAGCAAAACTCCATGTTCTTACCTTCTTTCCCCATGAACACAAACCCAGTTTCTGAAACAATGTTGTTTGGAGAACCAGATCCGGATCTCAACTCGGGTCAAATCATGGATTGGCTAGAAGACTCACTACCATACCTTCCATCTCTTTTAGATGATCTCTATGATTCCACTGATATCATCGATGATCCATGGTGGGCACCAGTGGAAGAGCTAGAACAATCTGTAGAGAACTTAACCAGTACAGTCAGCAGTAC...

CDS

Download CDS FASTA

1605 bp · TkA01G475170|TK1151|CDS

ATGATCAAGCAAAACTCCATGTTCTTACCTTCTTTCCCCATGAACACAAACCCAGTTTCTGAAACAATGTTGTTTGGAGAACCAGATCCGGATCTCAACTCGGGTCAAATCATGGATTGGCTAGAAGACTCACTACCATACCTTCCATCTCTTTTAGATGATCTCTATGATTCCACTGATATCATCGATGATCCATGGTGGGCACCAGTGGAAGAGCTAGAACAATCTGTAGAGAACTTAACCAGTACAGTCAGCAGTAC...

Protein

Download Protein FASTA

534 aa · TkA01G475170|TK1151|PROTEIN

MIKQNSMFLPSFPMNTNPVSETMLFGEPDPDLNSGQIMDWLEDSLPYLPSLLDDLYDSTDIIDDPWWAPVEELEQSVENLTSTVSSTVTSSAPSPPTELPGVPDQPPQPAFDLSKKRKAPPEEGKRSNGNKKGTGKSTKDSSGNSGNDGRWAEQLLKPCAAAIAAGNATRVQHLLFVLHELASPTGDANYRLASHGLQALLHHLSSSTNTPRKVVTPVTSFTTATPKFFQRSLINFNDINPWFTIPFNIANNAILQVLSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G475170`
TK1151 ID	TkA01G475170
OH-1004 ID	LXL04_002190
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G475170

Location Chr01:118954097-118955737 (+)

Description Similar to NSP1: Protein NODULATION SIGNALING PATHWAY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13840`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0408600`	Transcription factor involved in the control of strigolactone biosynthesis in roots through the activation of the beta-carotene isomerase D27, which participates in a pathway leading to biosynthesis of strigolactones.	Strigolactone biosynthesis in Medicago truncatula and rice requires the symbiotic GRAS-type transcription factors NSP1 and NSP2.2011 · DOI: 10.1105/tpc.111.089771
`UniProt: A2YN56`	Transcription factor required for the asymmetric cell division involved in radial pattern formation in roots.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002190 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009877 nodulation Biological Process

GO:0042446 hormone biosynthetic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G13840

ath:AT3G49950

mtr:11434050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · TkA01G475170 · TK1151

Cytoplasm0.156

Rank 2 · TkA01G475170 · TK1151

Cell membrane0.041

Rank 3 · TkA01G475170 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA01G475170 · TK1151

Plastid0.024

Rank 5 · TkA01G475170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514GRAS23-59 aa

PF03514GRAS153-526 aa

PF13578Methyltransf_24273-403 aa

PF13578Methyltransf_24486-511 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G475170	`PF03514`	GRAS	23	59	2.3e-79	267.8
TkA01G475170	`PF03514`	GRAS	153	526	2.3e-79	267.8
TkA01G475170	`PF13578`	Methyltransf_24	273	403	0.14	13.8
TkA01G475170	`PF13578`	Methyltransf_24	486	511	0.14	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRW3`	Arabidopsis thaliana	sp\|Q9LRW3\|SCL29_ARATH Scarecrow-like protein 29	55.400%	Swiss-Prot	High
`Q84MQ9`	Oryza sativa subsp. japonica	sp\|Q84MQ9\|NSP1_ORYSJ Protein NODULATION SIGNALING PATHWAY 1	43.600%	Swiss-Prot	Medium
`A2YN56`	Oryza sativa subsp. indica	sp\|A2YN56\|SHR1_ORYSI Protein SHORT-ROOT 1	28.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card