TkA01G471560 | RubberDandelionOmics

Gene overview

TkA01G471560

Reference: TK1151 Chr: Chr01 Coordinates: 118041803-118045101 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1150 bp · TkA01G471560|TK1151|cDNA

AAGTATACTTATATATTCAGGGGTTTAACAGAAAGCTCTCTAACTCTCAAGACGCAACTCCAAATTTGTTTAGCCCCCGAAGACGTTTCTCAGTATTCTCGATACAGAATTCGATCTTCCAAGTTCAAGATTGTGAGGATTTCACGAAAATTCTGCAGAAAAATGGGTGATCAAATATCACCCGTCATCAGAGACAGAGATCGGGAGCTGCTTCTCCCCATCGCCAACACCCCTGATGACCAACAAGCATCTCCAAAACC...

CDS

Download CDS FASTA

537 bp · TkA01G471560|TK1151|CDS

ATGGTTTTCTTCTCTCCTATTTTGGCTCAACTTGGCATAAGTATATTTGGTCTTGGATTTATAACTTCAGTGAGTTTCATATTTGTGGTGGGGATCTTTATGTCATCATGGTTGGGTGCATCTGTTTTAAGCCTTGGTGAATGGTTTATTAAACGCATGCCTTTTGTTCGCCATATTTATGATGCCTCTAAACAAATCAGTGCTGCCATCTCTCCAGATCAAAATTCACGAGCATTTAAGGAAGTTGTGATTATGAGGCA...

Protein

Download Protein FASTA

178 aa · TkA01G471560|TK1151|PROTEIN

MVFFSPILAQLGISIFGLGFITSVSFIFVVGIFMSSWLGASVLSLGEWFIKRMPFVRHIYDASKQISAAISPDQNSRAFKEVVIMRHPRVGEYAFGFITSSFTLRSYSEEEELYSVYVPTNHLYIGDIFLVNSKDVIRPNLSVREGIEIVVSGGMSMPQILTTFDLGIKEYGPRNNRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G471560`
TK1151 ID	TkA01G471560
OH-1004 ID	LXL04_002555
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.876 / OH-1004 66.920 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G471560

Location Chr01:118041803-118045101 (+)

Description Similar to COV1: Protein CONTINUOUS VASCULAR RING 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20120`	Involved in the regulation of vascular patterning in the stem, probably by negatively regulating the differentiation of vascular tissue.	Isolation of COV1, a gene involved in the regulation of vascular patterning in the stem of Arabidopsis.2003 · DOI: 10.1242/dev.00441
`At2g20130`	Protein LIKE COV 1.	No verified direct reference in this release
`At2g18460`	Protein LIKE COV 3.	No verified direct reference in this release
`At1g43130`	Protein LIKE COV 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002555 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G43130

ath:AT2G18460

ath:AT2G20120

ath:AT2G20130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.429

Rank 1 · TkA01G471560 · TK1151

Golgi apparatus0.238

Rank 2 · TkA01G471560 · TK1151

Cell membrane0.124

Rank 3 · TkA01G471560 · TK1151

Lysosome / Vacuole0.103

Rank 4 · TkA01G471560 · TK1151

Cytoplasm0.097

Rank 5 · TkA01G471560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04367DUF50222-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G471560	`PF04367`	DUF502	22	122	1.2e-26	93.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IUE7`	Arabidopsis thaliana	sp\|F4IUE7\|COV1_ARATH Protein CONTINUOUS VASCULAR RING 1	82.200%	Swiss-Prot	High
`Q8VY49`	Arabidopsis thaliana	sp\|Q8VY49\|LCV1_ARATH Protein LIKE COV 1	79.400%	Swiss-Prot	High
`F4IQJ6`	Arabidopsis thaliana	sp\|F4IQJ6\|LCV3_ARATH Protein LIKE COV 3	69.400%	Swiss-Prot	High
`Q9C8C1`	Arabidopsis thaliana	sp\|Q9C8C1\|LCV2_ARATH Protein LIKE COV 2	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card