TkA01G471210 | RubberDandelionOmics

Gene overview

TkA01G471210

Reference: TK1151 Chr: Chr01 Coordinates: 117959470-117964617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1723 bp · TkA01G471210|TK1151|cDNA

GGGAAATTTCTTTGCCTTTTCATCCACGCTAAAGTGCGTGCGGCGGTGCGGCAAACGATGTGTCTATTTTCACAGTAAAAACCATTTGCGCCCACAGTCATCAATACAATCACAATATCCCCCCACTTCTCTCTCAGATCACACTCATCTTTGTAATCAATCACAGCAAACCCCAGAAATCATTCCTGAAGAAATATGTCGGATTCCGTCTTCTGCCAAATCGCCCAAGCTCCTGAAGATCCTATCTTAGGGGTTACAGT...

CDS

Download CDS FASTA

1221 bp · TkA01G471210|TK1151|CDS

ATGTCGGATTCCGTCTTCTGCCAAATCGCCCAAGCTCCTGAAGATCCTATCTTAGGGGTTACAGTTGCTTACAACAAAGATCCAGACTCTTCAAAGTTAAATTTGGGTGTAGGTGCTTATCGAACTGAGGAAGGAAAACCTCTGGTTCTAAATGTTGTAAGACAGGCAGAACAAAAGCTTGTCAATGACCCGACTCGGATTAAGGAATATCTTCCTATTGTTGGACTTGCAGATTTCAATAAAGCTAGCGCCAAACTCAT...

Protein

Download Protein FASTA

406 aa · TkA01G471210|TK1151|PROTEIN

MSDSVFCQIAQAPEDPILGVTVAYNKDPDSSKLNLGVGAYRTEEGKPLVLNVVRQAEQKLVNDPTRIKEYLPIVGLADFNKASAKLIFGADSPAIQEKRVATVQCLSGSGSLRVGGEFLARHYHQKTIYIPDPTWGNHPKIFTFAGLSVKTYRYYDPSTRGLHFKGLLEDLGNAASGSIVLLHACAHNPTGVDPTIDQWEEIRQLVRSKQLLPFFDSAYQGFASGSLEADAKPVRMFVADGGECFTAQSFAKNMGLYGER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G471210`
TK1151 ID	TkA01G471210
OH-1004 ID	LXL04_002551
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G471210

Location Chr01:117959470-117964617 (+)

Description Similar to Os01g0760600: Aspartate aminotransferase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11520`	Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids.	The aspartate aminotransferase gene family of Arabidopsis encodes isoenzymes localized to three distinct subcellular compartments.1995 · DOI: 10.1046/j.1365-313x.1995.07010061.x
`At5g19550`	Important for the metabolism of amino acids and Krebs-cycle related organic acids.	Molecular and physiological analysis of Arabidopsis mutants defective in cytosolic or chloroplastic aspartate aminotransferase.2002 · DOI: 10.1104/pp.005090 root uv-b sensitive mutants are suppressed by specific mutations in ASPARTATE AMINOTRANSFERASE2 and by exogenous vitamin B6.2011 · DOI: 10.1093/mp/ssr033 The aspartate aminotransferase gene family of Arabidopsis encodes isoenzymes localized to three distinct subcellular compartments.1995 · DOI: 10.1046/j.1365-313x.1995.07010061.x Recombinant expression, purification, and characterization of three isoenzymes of aspartate aminotransferase from Arabidopsis thaliana.1998 · DOI: 10.1006/prep.1997.0845 Arabidopsis mutants define an in vivo role for isoenzymes of aspartate aminotransferase in plant nitrogen assimilation.1998 · DOI: 10.1093/genetics/149.2.491

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0760600`	Important for the metabolism of amino acids and Krebs-cycle related organic acids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006103 2-oxoglutarate metabolic process Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006522 alanine metabolic process Biological Process

GO:0006531 aspartate metabolic process Biological Process

GO:0006536 glutamate metabolic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT5G11520

ath:AT5G19550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · TkA01G471210 · TK1151

Nucleus0.229

Rank 2 · TkA01G471210 · TK1151

Mitochondrion0.160

Rank 3 · TkA01G471210 · TK1151

Peroxisome0.111

Rank 4 · TkA01G471210 · TK1151

Plastid0.054

Rank 5 · TkA01G471210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_231-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G471210	`PF00155`	Aminotran_1_2	31	397	1.9e-98	330.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46644`	Arabidopsis thaliana	sp\|P46644\|AAT3_ARATH Aspartate aminotransferase 3, chloroplastic	82.500%	Swiss-Prot	High
`P46645`	Arabidopsis thaliana	sp\|P46645\|AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1	79.700%	Swiss-Prot	High
`P37833`	Oryza sativa subsp. japonica	sp\|P37833\|AATC_ORYSJ Aspartate aminotransferase, cytoplasmic	81.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card