Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1232 bp · TkA01G468280|TK1151|cDNA
GGCGGGAACGTTCCCTCTCGTCGAAATCATGAAATATTTCCAGCAATAATCGTAGAAGTGAAAAAAGCGATTAGGGCAAATATCCATGGTAATTACCAAACAAATCGAGTCCTCATATGATTATATCATGTCTCCATCTCTGTACATATGCCATTAGGGGTAAATCTCCATCCGCCTCCATAGAAGAGAGTGTTCAACCAAATCCAGTACTTCTCTGCTTTCGATCAACATCCTGAGCCCCTCTCCTGATTTCGTATTCA...
585 bp · TkA01G468280|TK1151|CDS
ATGCTCAAAGATTATTCAATCCTTCTTCTTCCCCACCACCAATCACAACAAGTGCCTAGCAGTAAGCTCCCAAAGGGACGTCATTTGAGCGATGATGGTGTTTCATATGATATAGATGTTAGGTTGCCGGGAGAGGGTCAGCCTCAACTTGAGGTCACTCCCATTACCAAGTATGGGTCTGATCCTGGTCTCGTTGTGGGTCGTCAGATTGCTGTTAACAAGGCTTATATATGTTATGGTTTGAAACTGGGAGCAATCAG...
Protein
Download Protein FASTA194 aa · TkA01G468280|TK1151|PROTEIN
MLKDYSILLLPHHQSQQVPSSKLPKGRHLSDDGVSYDIDVRLPGEGQPQLEVTPITKYGSDPGLVVGRQIAVNKAYICYGLKLGAIRVLNIHTALRSLLKRVTDMVFFAEDVHVLVSASIDGRVYVWKIQKGQMKMTSHKLQGRLLLRFRSQEKGNLFILEFVGPFLTPGVVLCFLLFLCCALLALGLHLEFFL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G468280 |
|---|---|
| TK1151 ID | TkA01G468280 |
| OH-1004 ID | LXL04_016122 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 76.000 |
| Protein coverage (%) | TK1151 73.196 / OH-1004 11.496Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G468280 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:117271014-117272399 (-) | |||||||||
| Description | Similar to VCR: Varicose-related protein | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA Biological Process GO:0006397 mRNA processing Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0007186 G protein-coupled receptor signaling pathway Biological Process GO:0009791 post-embryonic development Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010071 root meristem specification Biological Process GO:0010072 primary shoot apical meristem specification Biological Process GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA Biological Process GO:0071365 cellular response to auxin stimulus Biological Process GO:0000932 P-body Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G13290 ath:AT3G13300 hsa:23644 mmu:234699 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16529Ge1_WD4050-138 aaPF24796WDR5569-92 aaPF24106Beta-prop_EDC4L70-130 aaPF17005WD40_like70-139 aaPF23411Beta-prop_Vps4171-139 aaPF23414Beta-prop_EML_273-138 aaPF25171Beta-prop_WDR36-Utp21_1st80-137 aaPF25178Beta-prop_WDR4181-139 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G468280 | PF16529 | Ge1_WD40 | 50 | 138 | 2e-05 | 24.4 |
| TkA01G468280 | PF24796 | WDR55 | 69 | 92 | 0.0017 | 18.2 |
| TkA01G468280 | PF24106 | Beta-prop_EDC4L | 70 | 130 | 0.13 | 12.0 |
| TkA01G468280 | PF17005 | WD40_like | 70 | 139 | 0.25 | 11.4 |
| TkA01G468280 | PF23411 | Beta-prop_Vps41 | 71 | 139 | 0.2 | 11.6 |
| TkA01G468280 | PF23414 | Beta-prop_EML_2 | 73 | 138 | 0.35 | 10.9 |
| TkA01G468280 | PF25171 | Beta-prop_WDR36-Utp21_1st | 80 | 137 | 0.0059 | 16.8 |
| TkA01G468280 | PF25178 | Beta-prop_WDR41 | 81 | 139 | 0.0068 | 15.9 |
| TkA01G468280 | PF25391 | WD40_Gbeta | 90 | 129 | 0.077 | 12.7 |
| TkA01G468280 | PF24105 | Beta-prop_CAF1B_HIR1 | 91 | 136 | 0.0041 | 16.9 |
| TkA01G468280 | PF24814 | WD40_Prp19 | 92 | 139 | 0.0094 | 15.8 |
| TkA01G468280 | PF25173 | Beta-prop_WDR3_1st | 95 | 139 | 0.0069 | 16.8 |
| TkA01G468280 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 99 | 134 | 0.012 | 15.6 |
| TkA01G468280 | PF23775 | Beta-prop_RIG_2nd | 100 | 136 | 0.061 | 13.4 |
| TkA01G468280 | PF24796 | WDR55 | 101 | 146 | 0.0017 | 18.2 |
| TkA01G468280 | PF00400 | WD40 | 101 | 127 | 0.043 | 15.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.