TkA01G464280 | RubberDandelionOmics

Gene overview

TkA01G464280

Reference: TK1151 Chr: Chr01 Coordinates: 116327032-116328922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA01G464280|TK1151|cDNA

ATACAGACACACGGATCAGTGACTCATCCGCCTATCCCACCTTCTCCGTTAAATACTTCCCCAAAATCATATCATCTCTCAGATACACCGTTCTCCGATTCCATTTCAACACTGAACTTGCCGGATCTTTTCGAGTTGAGAAGCGCGAAGAGATCGTCGATCATCAGGCGCTCAAATATGACGGTGGAGCTGTTCGGAGATCGAAGCTGTTTCCGTTCACGCTTTTCTTCTTCAATTTGCTATCAAATGTTGAATGAAAA...

CDS

Download CDS FASTA

573 bp · TkA01G464280|TK1151|CDS

ATACAGACACACGGATCAGTGACTCATCCGCCTATCCCACCTTCTCCGTTAAATACTTCCCCAAAATCATATCATCTCTCAGATACACCGTTCTCCGATTCCATTTCAACACTGAACTTGCCGGATCTTTTCGAGTTGAGAAGCGCGAAGAGATCGTCGATCATCAGGCGCTCAAATATGACGGTGGAGCTGTTCGGAGATCGAAGCTGTTTCCGTTCACGCTTTTCTTCTTCAATTTGCTATCAAATGTTGAATGAAAA...

Protein

Download Protein FASTA

190 aa · TkA01G464280|TK1151|PROTEIN

IQTHGSVTHPPIPPSPLNTSPKSYHLSDTPFSDSISTLNLPDLFELRSAKRSSIIRRSNMTVELFGDRSCFRSRFSSSICYQMLNENEFESVKGSGGCVDAVSAAIETLEHHCRNCGDIFCDKCTQGRIALTAEENAQQVRVCDQCMAEVTQRLSHVNEVAANKASGFNRHEDLAKKLQVLKTVSPKSNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G464280`
TK1151 ID	TkA01G464280
OH-1004 ID	LXL04_006839
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.400
Protein coverage (%)	TK1151 94.211 / OH-1004 71.691 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G464280

Location Chr01:116327032-116328922 (+)

Description Similar to FREE1: Protein FREE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20110`	Endosomal sorting complex required for transport (ESCRT) component regulating multivesicular body (MVB) protein sorting and plant growth.	A unique plant ESCRT component, FREE1, regulates multivesicular body protein sorting and plant growth.2014 · DOI: 10.1016/j.cub.2014.09.014 Dual roles of an Arabidopsis ESCRT component FREE1 in regulating vacuolar protein transport and autophagic degradation.2015 · DOI: 10.1073/pnas.1421271112 FYVE1 is essential for vacuole biogenesis and intracellular trafficking in Arabidopsis.2015 · DOI: 10.1104/pp.114.253377 FYVE1/FREE1 Interacts with the PYL4 ABA Receptor and Mediates Its Delivery to the Vacuolar Degradation Pathway.2016 · DOI: 10.1105/tpc.16.00178 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006839 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

GO:0071474 cellular hyperosmotic response Biological Process

GO:0080135 regulation of cellular response to stress Biological Process

GO:1900067 regulation of cellular response to alkaline pH Biological Process

GO:0000813 ESCRT I complex Cellular Component

KEGG gene cross-reference

ath:AT1G20110

ddi:DDB_G0292924

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · TkA01G464280 · TK1151

Nucleus0.381

Rank 2 · TkA01G464280 · TK1151

Cell membrane0.111

Rank 3 · TkA01G464280 · TK1151

Mitochondrion0.099

Rank 4 · TkA01G464280 · TK1151

Golgi apparatus0.068

Rank 5 · TkA01G464280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14634zf-RING_579-84 aa

PF28826TpcD-like_N100-141 aa

PF00643zf-B_box107-127 aa

PF22601RIM2a_ZnF109-146 aa

PF22586ANCHR-like_BBOX109-125 aa

PF01363FYVE110-151 aa

PF14634zf-RING_5110-146 aa

PF00643zf-B_box139-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G464280	`PF14634`	zf-RING_5	79	84	8.0	7.2
TkA01G464280	`PF28826`	TpcD-like_N	100	141	0.025	15.8
TkA01G464280	`PF00643`	zf-B_box	107	127	0.12	13.3
TkA01G464280	`PF22601`	RIM2a_ZnF	109	146	0.0086	16.7
TkA01G464280	`PF22586`	ANCHR-like_BBOX	109	125	0.16	12.8
TkA01G464280	`PF01363`	FYVE	110	151	5.6e-12	46.3
TkA01G464280	`PF14634`	zf-RING_5	110	146	8.0	7.2
TkA01G464280	`PF00643`	zf-B_box	139	147	0.12	13.3
TkA01G464280	`PF22586`	ANCHR-like_BBOX	142	151	0.16	12.8
TkA01G464280	`PF14634`	zf-RING_5	142	151	8.0	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS2`	Arabidopsis thaliana	sp\|Q9ASS2\|FREE1_ARATH Protein FREE1	61.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card