Gene Card
Gene overview
cDNA / CDS / Protein Sequences
688 bp · TkA01G462700|TK1151|cDNA
CCCACCAACCCCAAGTACTACATTTAGATCCCAAATTCCCAATACCCTTTTACAGATCATAAAAATAACTCCCTATATACATATCATTCTTATTTGTCAAAGATTTGAAACTGGTGAGAGCGAGGATATACACATATCAGAAAAAATGAGATTTATTTCAAGTGGTGATTTTTTAAGAGACATTGTCGTCAATTGAAACAATTGATGACACTTCTTCTTCGGCATCATCACAAGAGGGTCCATTGTATAGGTTATCCGAG...
405 bp · TkA01G462700|TK1151|CDS
ATGGCACAATTACCTATCAGGAGAGGTTTATCAAGTACTATCAAGGGAAATCGGAGTCATCTTGAATCACTTGCAAATTTAAAGAGCTTTGAAGATCTTGCAAAAAGGAGTCATAAAATCAAGAAGGTCAACGAAATCAATCATTCGGAAAGTGGTCATAGTCAAAAATTAAATCCCCAAGGGAAAATTGTCAAAAACAAAAGGAGTCCTTCATCTTTCATTGTAAAGAGTTTCTATATTCTTCCTTTCAAGCAAACCTT...
Protein
Download Protein FASTA134 aa · TkA01G462700|TK1151|PROTEIN
MAQLPIRRGLSSTIKGNRSHLESLANLKSFEDLAKRSHKIKKVNEINHSESGHSQKLNPQGKIVKNKRSPSSFIVKSFYILPFKQTFCKLYTYKVRECKHREGSILVVFLNMNKYLEETISSKYERILYNPLKP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G462700 |
|---|---|
| TK1151 ID | TkA01G462700 |
| OH-1004 ID | LXL04_018636 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 36.800 |
| Protein coverage (%) | TK1151 53.731 / OH-1004 44.706Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G462700 |
|---|---|
| Location | Chr01:115972626-115973450 (-) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0010043 response to zinc ion Biological Process GO:0010114 response to red light Biological Process GO:0010218 response to far red light Biological Process GO:0046686 response to cadmium ion Biological Process GO:0046688 response to copper ion Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:2000070 regulation of response to water deprivation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component |
| KEGG gene cross-reference | ath:AT3G43850 ath:AT5G21940 ath:AT5G56550 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.