TkA01G462240 | RubberDandelionOmics

Gene overview

TkA01G462240

Reference: TK1151 Chr: Chr01 Coordinates: 115859347-115861018 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1489 bp · TkA01G462240|TK1151|cDNA

ATTTCTCTCCCTAGATACATACACACTCGTTATATACACATCCCCTCTCTCTCTCTCTCTCTCTCTTCCATTTTTCCCTCTTAATACTGATATTTAAAATTTGTCAGCAGTTACAATCTCTTTCTCTCTCTCTCTCTCTCTCTTATTATATTTTTTTGACATTTGAGGACGAAAAATGGGGAAGGCGATGAGGTGGTTGAAGGGGTTGTTCGGTTCCAAAAACGAAAAAGACCAATCAAATTCCGGTAACCGGAAAGACA...

CDS

Download CDS FASTA

1098 bp · TkA01G462240|TK1151|CDS

ATGGGGAAGGCGATGAGGTGGTTGAAGGGGTTGTTCGGTTCCAAAAACGAAAAAGACCAATCAAATTCCGGTAACCGGAAAGACAAGATTGCCTCATGCATCGGGCGGCCACGTCGCCATCCCTCCACTTCACCGCCGGAAACTCCCATTCTAAAACCAACTTACAACAGCAATTCCGCAGAGCACAACAAACGTGCGATTGCAGTAGCTGCCGCCACCGCCGCAGCTGCTGACGCTGCCGTCGCTGCCGCCCACGCCGC...

Protein

Download Protein FASTA

365 aa · TkA01G462240|TK1151|PROTEIN

MGKAMRWLKGLFGSKNEKDQSNSGNRKDKIASCIGRPRRHPSTSPPETPILKPTYNSNSAEHNKRAIAVAAATAAAADAAVAAAHAAVAFVRLTSKNRVTTRENSAAIRIQALFRGYLSRKALKALKSLVKLQAVVRGYLVRKEAAETLHGMEALIRAQSTVCAHRIRLQDDKTHSRRSIKRANEARSRRISTSFQASFDGRPSPIEESPEDPISKLTRASTWAWGPGSGAQTPTFTNPHHLSTPSLPNHHVFEYGFLTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G462240`
TK1151 ID	TkA01G462240
OH-1004 ID	LXL04_002485
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G462240

Location Chr01:115859347-115861018 (+)

Description Similar to IQD20: Protein IQ-DOMAIN 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16490`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g29150`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g51960`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g62070`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g23060`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002485 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G51960

ath:AT3G16490

ath:AT4G00820

ath:AT4G14750

ath:AT4G29150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.403

Rank 1 · TkA01G462240 · TK1151

Cell membrane0.375

Rank 2 · TkA01G462240 · TK1151

Nucleus0.374

Rank 3 · TkA01G462240 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA01G462240 · TK1151

Plastid0.040

Rank 5 · TkA01G462240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13178DUF400538-99 aa

PF00612IQ105-124 aa

PF26038Dimer_MINDY4_N111-124 aa

PF00612IQ127-144 aa

PF26038Dimer_MINDY4_N133-156 aa

PF13178DUF4005153-177 aa

PF20653COG6_C168-214 aa

PF13178DUF4005261-317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G462240	`PF13178`	DUF4005	38	99	5.2e-11	43.7
TkA01G462240	`PF00612`	IQ	105	124	2.9e-12	45.9
TkA01G462240	`PF26038`	Dimer_MINDY4_N	111	124	0.003	18.7
TkA01G462240	`PF00612`	IQ	127	144	2.9e-12	45.9
TkA01G462240	`PF26038`	Dimer_MINDY4_N	133	156	0.003	18.7
TkA01G462240	`PF13178`	DUF4005	153	177	5.2e-11	43.7
TkA01G462240	`PF20653`	COG6_C	168	214	0.085	12.3
TkA01G462240	`PF13178`	DUF4005	261	317	5.2e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK76`	Arabidopsis thaliana	sp\|Q9LK76\|IQD26_ARATH Protein IQ-domain 26	40.200%	Swiss-Prot	Medium
`F4JMV6`	Arabidopsis thaliana	sp\|F4JMV6\|IQD25_ARATH Protein IQ-DOMAIN 25	32.600%	Swiss-Prot	Medium
`Q9ZU28`	Arabidopsis thaliana	sp\|Q9ZU28\|IQD27_ARATH Protein IQ-DOMAIN 27	33.900%	Swiss-Prot	Medium
`Q9FIT1`	Arabidopsis thaliana	sp\|Q9FIT1\|IQD23_ARATH Protein IQ-DOMAIN 23	29.600%	Swiss-Prot	Low
`Q2NNE0`	Arabidopsis thaliana	sp\|Q2NNE0\|IQD22_ARATH Protein IQ-DOMAIN 22	27.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card