Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2137 bp · TkA01G461770|TK1151|cDNA
GCACATCTTGTCTCTGTTACAGTTGCTTCGCCGATATTATTGTCTCTTTTACCCTACTCTTTCAGAATCATTAATATCCGCAAATTGTATGAGTCTTTGAGAGTTCCTGTTTCCTTTAGATAGTGGGGTTTCATCCAACAGTGTATTTACACACAAATCCAGCATAGTCAAGCTCAAATCGTCGCTTTCTAAACATAGATTAAACCAAAAGGGTATCCTTTTTCCAGGAAAGAAAAGTCCAATCTTGTGATTCTGTTTCT...
1314 bp · TkA01G461770|TK1151|CDS
ATGACCGTCGAGATGCACGCCGGACTTGCCTCCGATGGCGGCAGCAAGCTCAAGATGCTAATCAGCTACGTTGACAACCTCCCCACTGGGGACGAAACTGGAATTTTCTATGCTCTTGATCTTGGGGGTACAAACTTCCGTGTTCTTCGGGTGAAATTGGGTGGAGCTGACAATGTGAAGAAAGAATTTACAGAAGTTTCAATTCCTTCACATCTCATGACTGGAACATGTGAAGATTTATTTGATTTTATTGCTGGAGA...
Protein
Download Protein FASTA437 aa · TkA01G461770|TK1151|PROTEIN
MTVEMHAGLASDGGSKLKMLISYVDNLPTGDETGIFYALDLGGTNFRVLRVKLGGADNVKKEFTEVSIPSHLMTGTCEDLFDFIAGELAKFVATEGEDMHITAGTQRELGFTFSFPVKQSSIAGGTLVRWTKGFNIEDAVGQDVVDELTKAMERIGLDMRVSALVNDTVGTLAGGRYSNTNVIAAVILGTGTNAAYVERANAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEFDENLDNASLNPGEQIFEKIISGMYL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G461770 |
|---|---|
| TK1151 ID | TkA01G461770 |
| OH-1004 ID | LXL04_002486 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 87.751Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G461770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:115734488-115739422 (-) | |||||||||
| Description | Similar to HXK2: Hexokinase-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001678 intracellular glucose homeostasis Biological Process GO:0006006 glucose metabolic process Biological Process GO:0006096 glycolytic process Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009747 hexokinase-dependent signaling Biological Process GO:0010148 transpiration Biological Process GO:0010182 sugar mediated signaling pathway Biological Process GO:0010255 glucose mediated signaling pathway Biological Process GO:0012501 programmed cell death Biological Process GO:0019320 hexose catabolic process Biological Process GO:0051156 glucose 6-phosphate metabolic process Biological Process GO:0090332 stomatal closure Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G19860 ath:AT4G29130 nta:107797523 sot:102577690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00349Hexokinase_11-177 aaPF25677Chimallin_Phikzvirus142-193 aaPF03727Hexokinase_2184-425 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G461770 | PF00349 | Hexokinase_1 | 1 | 177 | 2.2e-68 | 230.7 |
| TkA01G461770 | PF25677 | Chimallin_Phikzvirus | 142 | 193 | 0.31 | 10.1 |
| TkA01G461770 | PF03727 | Hexokinase_2 | 184 | 425 | 3.7e-85 | 285.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.