TkA01G458490 | RubberDandelionOmics

Gene overview

TkA01G458490

Reference: TK1151 Chr: Chr01 Coordinates: 114816376-114819656 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · TkA01G458490|TK1151|cDNA

CTTATCCCTTCTGCCGGGTTCGCCACCACCACCGCCACCTACGGCGTCATCGTTTTTCAGCTCCGGCTATATAGACACCCACACATTTTGTTCTCTTTCTCTAGTTCTGCTTCTCATACAATACACAACATTGACAAGCACAAAACGTCGACGCTATACGGCTATACCCTTCTTTCCTGCAGCAAAACATTCATTTACGCTATCTAAACACACATCGTCGACAACTGCGAATGAATGGCTCGAGGATTACTCATGCTCCC...

CDS

Download CDS FASTA

1935 bp · TkA01G458490|TK1151|CDS

ATGGCTCGAGGATTACTCATGCTCCCACATTATAGTGCACAATCACACTTAATTCGAACCGGATTATCGTCACCGTCAAAGAGTTTCACTAAATTTCATACCTTTTCCATTCCAAAAAAATCCACCTATGTTCGATTACTGTGTAGCTATTCCTTTAATCTTCAAGATGATTCAATTGAACTCTCAAATTACAAAGAAACTTTCTCCAACCGTATGGCTATGGCTGGTCTCAAACCCCATCATCGTATCGCTGTGGGCGT...

Protein

Download Protein FASTA

644 aa · TkA01G458490|TK1151|PROTEIN

MARGLLMLPHYSAQSHLIRTGLSSPSKSFTKFHTFSIPKKSTYVRLLCSYSFNLQDDSIELSNYKETFSNRMAMAGLKPHHRIAVGVSGGPDSMALCLLAADWKTNGLNAASRRNKDSIDGLLAIIVDHGLRPESKDEAEIVQRRVLDTGIRCEIAHCKWTDGKPKLGHLQEAARDMRYEKLQNVCIQHHIGVLLIAHHADDQAELFILRLSRNSGVLGLAGMALTTQLFDDKSSNSILLVRPLLDFSKQDLYKICEEGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G458490`
TK1151 ID	TkA01G458490
OH-1004 ID	LXL04_002532
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G458490`
Location	Chr01:114816376-114819656 (-)
Description	Similar to tilS: tRNA(Ile)-lysidine synthase (Rickettsia bellii (strain RML369-C)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002532` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0005737 cytoplasm Cellular Component GO:0005524 ATP binding Molecular Function GO:0032267 tRNA(Ile)-lysidine synthase activity Molecular Function
KEGG gene cross-reference	hne:HNE_0157 rbe:RBE_1394 rbo:A1I_07755 wol:WD_1254 wri:WRi_012290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.856

Rank 1 · TkA01G458490 · TK1151

Mitochondrion0.163

Rank 2 · TkA01G458490 · TK1151

Cytoplasm0.058

Rank 3 · TkA01G458490 · TK1151

Nucleus0.050

Rank 4 · TkA01G458490 · TK1151

Peroxisome0.018

Rank 5 · TkA01G458490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01171ATP_bind_370-285 aa

PF20991CBP66_1st171-199 aa

PF20991CBP66_1st277-290 aa

PF10021PARG_cat_microb419-495 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G458490	`PF01171`	ATP_bind_3	70	285	4.2e-61	206.7
TkA01G458490	`PF20991`	CBP66_1st	171	199	0.16	12.9
TkA01G458490	`PF20991`	CBP66_1st	277	290	0.16	12.9
TkA01G458490	`PF10021`	PARG_cat_microb	419	495	0.18	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card