TkA01G456900 | RubberDandelionOmics

Gene overview

TkA01G456900

Reference: TK1151 Chr: Chr01 Coordinates: 114414853-114416693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · TkA01G456900|TK1151|cDNA

CAAGATTCTATTCTTCTATTTATATAGTTGGATAAGTGATTTTGGTCATAAAAATATTATCTTTTTTCTTTTCAAATTGTAAAATTGCATATCCATCCAATCATTTATTCTTAGGTTCGCAACCAGTTCTTCCAAAACCTCACCTCCTACCTCCTATACCTCCCACCACACATATATCATCATCAATATTTTGCCTTTTTGCCAAACCTAACATCTCCTTTTCCTTTTCTTTTAACTTTTCTCTTCTTTGGGTGTCCTTC...

CDS

Download CDS FASTA

882 bp · TkA01G456900|TK1151|CDS

ATGGGGAGAAAATGCTCACATTGTGGAAACATAGGCCACAATTCAAGAACTTGCACTAGTTTCAATAAAGGAAACGTCAATAGCACAATCTTGATAGGAGGTAATGGTGGAGGGGGATTGCGACTCTTTGGGGTTCAACTTGAAACACCACATTCTCTCGTCATGAAAAAATGCCTTAGCATGGATTGCCTACCTCCTTCTTCACCAATACCATCTTCAACTTCACCTTCACCATCGTCTTCCTTATCTTCCTCTAGGGT...

Protein

Download Protein FASTA

293 aa · TkA01G456900|TK1151|PROTEIN

MGRKCSHCGNIGHNSRTCTSFNKGNVNSTILIGGNGGGGLRLFGVQLETPHSLVMKKCLSMDCLPPSSPIPSSTSPSPSSSLSSSRVSVNDLKNMSVGYLSDGLIARAQERKKGLPWSEEEHRQFLTGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKYFLRQASIVKKKRRSSLFDLVRGDNNNAITNQENSYNMSQTNSYDEDHQDQSDNLSLIDFSSLKQENVYYNPNPMIKSYETTSMCSHMHVSPCGTIGSKSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G456900`
TK1151 ID	TkA01G456900
OH-1004 ID	LXL04_002446
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G456900

Location Chr01:114414853-114416693 (-)

Description Similar to MYBS3: Transcription factor MYBS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47390`	Transcriptional repressor.	A novel Arabidopsis MYB-like transcription factor, MYBH, regulates hypocotyl elongation by enhancing auxin accumulation.2013 · DOI: 10.1093/jxb/ert223 Transcriptional control of ROS homeostasis by KUODA1 regulates cell expansion during leaf development.2014 · DOI: 10.1038/ncomms4767 A single-repeat MYB transcription repressor, MYBH, participates in regulation of leaf senescence in Arabidopsis.2015 · DOI: 10.1007/s11103-015-0321-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0561400`	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 A novel MYBS3-dependent pathway confers cold tolerance in rice.2010 · DOI: 10.1104/pp.110.153015
`UniProt: B8BI93`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	No verified direct reference in this release
`Os10g0562100`	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002446 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010150 leaf senescence Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT5G47390

ath:AT5G61620

dosa:Os10g0562100

osa:4349391

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA01G456900 · TK1151

Cytoplasm0.093

Rank 2 · TkA01G456900 · TK1151

Cell membrane0.022

Rank 3 · TkA01G456900 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA01G456900 · TK1151

Plastid0.012

Rank 5 · TkA01G456900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00098zf-CCHC3-20 aa

PF27939DUF83633-29 aa

PF14392zf-CCHC_43-19 aa

PF15288zf-CCHC_63-18 aa

PF00249Myb_DNA-binding116-161 aa

PF15288zf-CCHC_6270-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G456900	`PF00098`	zf-CCHC	3	20	0.098	13.5
TkA01G456900	`PF27939`	DUF8363	3	29	0.33	11.5
TkA01G456900	`PF14392`	zf-CCHC_4	3	19	0.78	10.1
TkA01G456900	`PF15288`	zf-CCHC_6	3	18	2.5	8.8
TkA01G456900	`PF00249`	Myb_DNA-binding	116	161	8.4e-12	45.7
TkA01G456900	`PF15288`	zf-CCHC_6	270	278	2.5	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVS0`	Arabidopsis thaliana	sp\|Q9LVS0\|KUA1_ARATH Transcription factor KUA1	47.600%	Swiss-Prot	Medium
`Q7XC57`	Oryza sativa subsp. japonica	sp\|Q7XC57\|MYBS3_ORYSJ Transcription factor MYBS3	46.500%	Swiss-Prot	Medium
`B8BI93`	Oryza sativa subsp. indica	sp\|B8BI93\|MYBS2_ORYSI Transcription factor MYBS2	77.800%	Swiss-Prot	Low
`Q7XC51`	Oryza sativa subsp. japonica	sp\|Q7XC51\|MYBS2_ORYSJ Transcription factor MYBS2	77.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card