TkA01G452840 | RubberDandelionOmics

Gene overview

TkA01G452840

Reference: TK1151 Chr: Chr01 Coordinates: 113319087-113320806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

670 bp · TkA01G452840|TK1151|cDNA

ATGAAAAAGATAGCGCTAGTCGGACCATGGGGAGGATCAGGTGGAGAAAGCTGGTCTTTTAAAGGTAAGGGAAAGATCACAATGATATTCATCAACCATGGAGAAGTTATTGATTCCATCAGATTCGTTAGCCAAGATGACGACGATAATGAACTCCATTCACAAACATTTGGAGGTTCTGGTGGCGATTATAGTGAGGTTCTCATCGACCATGAAGTGGAGGAGTTGAATGAGATTAGCGGGACGATCGGATGGTTTGA...

CDS

Download CDS FASTA

438 bp · TkA01G452840|TK1151|CDS

ATGAAAAAGATAGCGCTAGTCGGACCATGGGGAGGATCAGGTGGAGAAAGCTGGTCTTTTAAAGGTAAGGGAAAGATCACAATGATATTCATCAACCATGGAGAAGTTATTGATTCCATCAGATTCGTTAGCCAAGATGACGACGATAATGAACTCCATTCACAAACATTTGGAGGTTCTGGTGGCGATTATAGTGAGGTTCTCATCGACCATGAAGTGGAGGAGTTGAATGAGATTAGCGGGACGATCGGATGGTTTGA...

Protein

Download Protein FASTA

145 aa · TkA01G452840|TK1151|PROTEIN

MKKIALVGPWGGSGGESWSFKGKGKITMIFINHGEVIDSIRFVSQDDDDNELHSQTFGGSGGDYSEVLIDHEVEELNEISGTIGWFDEKLVVTSLSFKTDVSKFGPFGRENGTHFSLPISKARFAGFYGRSSDYLHAIGAYIRPT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G452840`
TK1151 ID	TkA01G452840
OH-1004 ID	LXL04_015732
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	39.400
Protein coverage (%)	TK1151 93.793 / OH-1004 93.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G452840

Location Chr01:113319087-113320806 (-)

Description Similar to Mannose/glucose-specific lectin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52000`	Jacalin-related lectin 5.	No verified direct reference in this release
`UniProt: O65187`	Myrosinase-binding protein 1.	No verified direct reference in this release
`At1g52040`	Myrosinase-binding protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015732 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007157 heterophilic cell-cell adhesion Biological Process

GO:0005536 D-glucose binding Molecular Function

GO:0005537 D-mannose binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G73040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · TkA01G452840 · TK1151

Nucleus0.373

Rank 2 · TkA01G452840 · TK1151

Extracellular0.061

Rank 3 · TkA01G452840 · TK1151

Cell membrane0.053

Rank 4 · TkA01G452840 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA01G452840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01419Jacalin7-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G452840	`PF01419`	Jacalin	7	141	4.3e-34	118.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU23`	Arabidopsis thaliana	sp\|Q9ZU23\|JAL5_ARATH Jacalin-related lectin 5	27.900%	Swiss-Prot	Low
`O65187`	Arabidopsis thaliana	sp\|O65187\|JAL7L_ARATH Myrosinase-binding protein 1	27.900%	Swiss-Prot	Low
`Q9SAV0`	Arabidopsis thaliana	sp\|Q9SAV0\|JAL7_ARATH Myrosinase-binding protein 1	27.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card