TkA01G447150 | RubberDandelionOmics

Gene overview

TkA01G447150

Reference: TK1151 Chr: Chr01 Coordinates: 111940350-111941258 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA01G447150|TK1151|cDNA

ATGTGGGGATCACATGTAGCGGTGTATTCGGAAGCTTTTAGCCATGGTTTGGAAGATAGCCGAAAACCGCCATGGGGGTGGACAGATGAGGAAGTACAAGATGAGAACAGGGGATCTTCTTTTTCCTGTTCAAAGTTGCTGACGTGGCTAGAGTTTCCATTGATGTTACCAAGAAGGTTGACCATTCCCCTCATAGACGAAGAAAGATGGTCAAAAGGATATGCTGTGGCTAGCGTCACTTTTGCGCCTTTACTTCTAGC...

CDS

Download CDS FASTA

909 bp · TkA01G447150|TK1151|CDS

ATGTGGGGATCACATGTAGCGGTGTATTCGGAAGCTTTTAGCCATGGTTTGGAAGATAGCCGAAAACCGCCATGGGGGTGGACAGATGAGGAAGTACAAGATGAGAACAGGGGATCTTCTTTTTCCTGTTCAAAGTTGCTGACGTGGCTAGAGTTTCCATTGATGTTACCAAGAAGGTTGACCATTCCCCTCATAGACGAAGAAAGATGGTCAAAAGGATATGCTGTGGCTAGCGTCACTTTTGCGCCTTTACTTCTAGC...

Protein

Download Protein FASTA

302 aa · TkA01G447150|TK1151|PROTEIN

MWGSHVAVYSEAFSHGLEDSRKPPWGWTDEEVQDENRGSSFSCSKLLTWLEFPLMLPRRLTIPLIDEERWSKGYAVASVTFAPLLLAFLWNRVYNGGQLSEDLIYIGSAVVGCVLGVFAFFCTRKDQPPQKMLLPWVLGGFFMSIIWFYMVANELVALLVSLGLIFRVNSAILALTVLAWGNSMGDLMSNVALAMNGADGVQIAISGCYAGPMFNTLVGLGVSMLIGAWSRKPDSYVLSRDSGLLFNLGFIVIGLVWALV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G447150`
TK1151 ID	TkA01G447150
OH-1004 ID	LXL04_002307
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 50.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G447150

Location Chr01:111940350-111941258 (-)

Description Similar to CCX4: Cation/calcium exchanger 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14070`	May act as an endomembrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At1g54115`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At5g17860`	Vacuolar membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At5g17850`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At1g08960`	May act as a membrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K⁺ uptake and Na⁺ transport in yeast.2011 · DOI: 10.1016/j.bbrc.2011.09.030

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002307 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0010150 leaf senescence Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0043157 response to cation stress Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G54115

ath:AT3G14070

ath:AT5G17850

ath:AT5G17860

hsa:80024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.347

Rank 1 · TkA01G447150 · TK1151

Cell membrane0.336

Rank 2 · TkA01G447150 · TK1151

Cytoplasm0.185

Rank 3 · TkA01G447150 · TK1151

Endoplasmic reticulum0.154

Rank 4 · TkA01G447150 · TK1151

Golgi apparatus0.129

Rank 5 · TkA01G447150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex67-88 aa

PF01699Na_Ca_ex110-123 aa

PF248388xMP110-152 aa

PF01699Na_Ca_ex137-289 aa

PF248388xMP168-183 aa

PF21808Dynamin-like_hel_bact168-230 aa

PF248388xMP248-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G447150	`PF01699`	Na_Ca_ex	67	88	2.8e-29	102.7
TkA01G447150	`PF01699`	Na_Ca_ex	110	123	2.8e-29	102.7
TkA01G447150	`PF24838`	8xMP	110	152	0.26	11.8
TkA01G447150	`PF01699`	Na_Ca_ex	137	289	2.8e-29	102.7
TkA01G447150	`PF24838`	8xMP	168	183	0.26	11.8
TkA01G447150	`PF21808`	Dynamin-like_hel_bact	168	230	0.61	9.9
TkA01G447150	`PF24838`	8xMP	248	260	0.26	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJI2`	Arabidopsis thaliana	sp\|Q9LJI2\|CCX3_ARATH Cation/calcium exchanger 3	58.600%	Swiss-Prot	High
`Q9SYG9`	Arabidopsis thaliana	sp\|Q9SYG9\|CCX4_ARATH Cation/calcium exchanger 4	57.200%	Swiss-Prot	High
`Q9FKP1`	Arabidopsis thaliana	sp\|Q9FKP1\|CCX1_ARATH Cation/calcium exchanger 1	50.400%	Swiss-Prot	High
`Q9FKP2`	Arabidopsis thaliana	sp\|Q9FKP2\|CCX2_ARATH Cation/calcium exchanger 2	52.200%	Swiss-Prot	High
`O04034`	Arabidopsis thaliana	sp\|O04034\|CCX5_ARATH Cation/calcium exchanger 5	33.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card