TkA01G444930 | RubberDandelionOmics

Gene overview

TkA01G444930

Reference: TK1151 Chr: Chr01 Coordinates: 111357168-111358839 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · TkA01G444930|TK1151|cDNA

AGAGAAATCGTTTGGTCCGTTATTAAACGGTTAACTGCATCTCAAGTTCAGTCTCCCCAAATATCAGAAGCTTTTACAGTTATCCCTTTCGCAACCCTAGGAGATTCCTAATCGGGAAGCCTATGATACACCGAAGGAACCCATAAGGCAGAGCATCCGGAACGCCGACGACTCTTTCCGGTTCTCACCTTCGGCCGGGGAAGATCTTGCTACGCGAAAGGCTTACCTGTACCTTCTAATTCATTAATTTTGTTTGTACA...

CDS

Download CDS FASTA

624 bp · TkA01G444930|TK1151|CDS

ATGGAGGTTGCCGGCGCGCCGATCCGAGTTCAATCTATTGCAGAAAAGGATCTAAAAGTGGCGGTGCCGCCGCAGTACATACAACCACAGGAGAATCGACCTAGCAAGCCTAGTAACGGGAACGCCAATGATCATAAAATCCCCATGATAGACCTCGGCGGTGATAAGCAGGTGGACATCCTATGTGGGGAGATTAGGAGCGCATGCACAGAGTGGGGCGCCTTTCATGTAATCAACCACGGTGTATCCATCTCGTTGGT...

Protein

Download Protein FASTA

207 aa · TkA01G444930|TK1151|PROTEIN

MEVAGAPIRVQSIAEKDLKVAVPPQYIQPQENRPSKPSNGNANDHKIPMIDLGGDKQVDILCGEIRSACTEWGAFHVINHGVSISLVDEIRKIGSSFFEDLPMAEKLRYAYDSNSPASEGYGSRMLVASDDAVLDWRDYFDHHTFPLSRRNPSRWPHFPPNYREVIEQYSDEMKVLAVKLLGLISTSLGLPSSYIEEAMGKYTKTSP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G444930`
TK1151 ID	TkA01G444930
OH-1004 ID	LXL04_002282
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 97.101 / OH-1004 57.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G444930

Location Chr01:111357168-111358839 (+)

Description Similar to ANS: Probable 2-oxoglutarate-dependent dioxygenase ANS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63580`	Putative inactive flavonol synthase 2.	No verified direct reference in this release
`At1g55290`	2-oxoglutarate (OG)- and Fe(II)-dependent dioxygenase (2OGD)involved in scopoletin biosynthesis.	No verified direct reference in this release
`At3g13610`	May act as a 2-oxoglutarate- and Fe²⁺-dependent dioxygenase in scopoletin biosynthesis.	Scopoletin is biosynthesized via ortho-hydroxylation of feruloyl CoA by a 2-oxoglutarate-dependent dioxygenase in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03568.x Mutually exclusive alterations in secondary metabolism are critical for the uptake of insoluble iron compounds by Arabidopsis and Medicago truncatula.2013 · DOI: 10.1104/pp.113.220426 Feruloyl-CoA 6'-Hydroxylase1-dependent coumarins mediate iron acquisition from alkaline substrates in Arabidopsis.2014 · DOI: 10.1104/pp.113.228544
`At5g43440`	1-aminocyclopropane-1-carboxylate oxidase homolog 9.	No verified direct reference in this release
`At1g06640`	1-aminocyclopropane-1-carboxylate oxidase homolog 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0097237 cellular response to toxic substance Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900366 negative regulation of defense response to insect Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0045486 flavanone 3-dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38240

ath:AT3G11180

ath:AT3G55970

ath:AT5G05600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.697

Rank 1 · TkA01G444930 · TK1151

Nucleus0.547

Rank 2 · TkA01G444930 · TK1151

Endoplasmic reticulum0.038

Rank 3 · TkA01G444930 · TK1151

Plastid0.034

Rank 4 · TkA01G444930 · TK1151

Cell membrane0.031

Rank 5 · TkA01G444930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N47-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G444930	`PF14226`	DIOX_N	47	157	6.9e-25	88.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B2GVM7`	Arabidopsis thaliana	sp\|B2GVM7\|FLAS2_ARATH Putative inactive flavonol synthase 2	35.700%	Swiss-Prot	Medium
`Q9C899`	Arabidopsis thaliana	sp\|Q9C899\|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2	29.800%	Swiss-Prot	Low
`Q9LHN8`	Arabidopsis thaliana	sp\|Q9LHN8\|F6H1_ARATH Feruloyl CoA ortho-hydroxylase 1	29.700%	Swiss-Prot	Low
`Q9LSW7`	Arabidopsis thaliana	sp\|Q9LSW7\|ACCH9_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 9	29.100%	Swiss-Prot	Low
`Q9C5K7`	Arabidopsis thaliana	sp\|Q9C5K7\|ACCH2_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 2	29.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card