TkA01G443310 | RubberDandelionOmics

Gene overview

TkA01G443310

Reference: TK1151 Chr: Chr01 Coordinates: 110903286-110904185 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · TkA01G443310|TK1151|cDNA

ATGTGGGAGTGCCTATTAGTAAATTTGCATCTAGGAAATGAAATTACTTTTCCGTCGCTTTTGGAAATCGATCCCTGCATTCAATTTCTTCTTGAAGAAATCGATAACCCATCGCTCCAAAATCCATCCTTCCCAAAATCGATAACGTCATCGCTACAGATTCATCTTGCGAGATTGAGGGTTTTGATCGATTTCTCCCCCGAAAAACCTGCTACATTCATCGCTACAGATCTGGAGTTAGCAGGTCCGAATCTTCATTC...

CDS

Download CDS FASTA

900 bp · TkA01G443310|TK1151|CDS

ATGTGGGAGTGCCTATTAGTAAATTTGCATCTAGGAAATGAAATTACTTTTCCGTCGCTTTTGGAAATCGATCCCTGCATTCAATTTCTTCTTGAAGAAATCGATAACCCATCGCTCCAAAATCCATCCTTCCCAAAATCGATAACGTCATCGCTACAGATTCATCTTGCGAGATTGAGGGTTTTGATCGATTTCTCCCCCGAAAAACCTGCTACATTCATCGCTACAGATCTGGAGTTAGCAGGTCCGAATCTTCATTC...

Protein

Download Protein FASTA

299 aa · TkA01G443310|TK1151|PROTEIN

MWECLLVNLHLGNEITFPSLLEIDPCIQFLLEEIDNPSLQNPSFPKSITSSLQIHLARLRVLIDFSPEKPATFIATDLELAGPNLHSSLHSSCEIEDCEIEGFDRFLPQPSSASSLTKVCSCGRSESVVTSWIEEILTEIEGLAQTGILVSIDGQLTGILAISDPLKPGAREVISILKSMKIKSLLVTGDNWGTANSIAKEVGIEDVIAESKPEDKAEKVKSLQGSGFVVAMVGDGINDSPALVAADVRMAIGAGTDIAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G443310`
TK1151 ID	TkA01G443310
OH-1004 ID	LXL04_002266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G443310

Location Chr01:110903286-110904185 (-)

Description Similar to HMA5: Probable copper-transporting ATPase HMA5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63440`	Involved in copper import into the cell.	The Arabidopsis heavy metal P-type ATPase HMA5 interacts with metallochaperones and functions in copper detoxification of roots.2006 · DOI: 10.1111/j.1365-313x.2005.02601.x
`At5g44790`	Involved in copper import into the cell.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0556000`	Copper (Cu) transporter that plays an essential role in promoting translocation of Cu from roots to shoots.	A member of the heavy metal P-type ATPase OsHMA5 is involved in xylem loading of copper in rice.2013 · DOI: 10.1104/pp.113.226225
`Os02g0196600`	Copper (Cu) transporter that mediates Cu transport in root vacuoles.	A heavy metal P-type ATPase OsHMA4 prevents copper accumulation in rice grain.2016 · DOI: 10.1038/ncomms12138
`Os06g0665800`	Metal efflux transporter that may play a role in detoxification of heavy metals, such as zinc, copper, lead and cadmium, especially in the shoots.	Rice P1B-type heavy-metal ATPase, OsHMA9, is a metal efflux protein.2007 · DOI: 10.1104/pp.107.102236

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009636 response to toxic substance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010273 detoxification of copper ion Biological Process

GO:0046688 response to copper ion Biological Process

GO:0055070 copper ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071280 cellular response to copper ion Biological Process

GO:0005768 endosome Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G63440

ath:AT5G44790

dosa:Os02g0196600

dosa:Os04g0556000

dosa:Os06g0665800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · TkA01G443310 · TK1151

Nucleus0.242

Rank 2 · TkA01G443310 · TK1151

Plastid0.150

Rank 3 · TkA01G443310 · TK1151

Mitochondrion0.136

Rank 4 · TkA01G443310 · TK1151

Peroxisome0.083

Rank 5 · TkA01G443310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00702Hydrolase132-247 aa

PF08282Hydrolase_3167-208 aa

PF08282Hydrolase_3230-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G443310	`PF00702`	Hydrolase	132	247	1.3e-21	78.6
TkA01G443310	`PF08282`	Hydrolase_3	167	208	0.0037	17.8
TkA01G443310	`PF08282`	Hydrolase_3	230	269	0.0037	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SH30`	Arabidopsis thaliana	sp\|Q9SH30\|HMA5_ARATH Probable copper-transporting ATPase HMA5	78.600%	Swiss-Prot	Low
`Q9S7J8`	Arabidopsis thaliana	sp\|Q9S7J8\|HMA7_ARATH Copper-transporting ATPase RAN1	56.000%	Swiss-Prot	Low
`A3AWA4`	Oryza sativa subsp. japonica	sp\|A3AWA4\|HMA5_ORYSJ Copper-transporting ATPase HMA5	71.900%	Swiss-Prot	Low
`Q6H7M3`	Oryza sativa subsp. japonica	sp\|Q6H7M3\|HMA4_ORYSJ Copper-transporting ATPase HMA4	63.400%	Swiss-Prot	Low
`A0A0P0X004`	Oryza sativa subsp. japonica	sp\|A0A0P0X004\|HMA9_ORYSJ Cation-transporting ATPase HMA5	59.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card