TkA01G442990 | RubberDandelionOmics

Gene overview

TkA01G442990

Reference: TK1151 Chr: Chr01 Coordinates: 110786498-110795028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5331 bp · TkA01G442990|TK1151|cDNA

ATTACTTTTGTGTTGGGGTACTGCCGTACTGGGTTAGTGGGATACTTCTACAGTTGTCTTTTGTTGAGAAGTCACGATTTTAGAAGTTAAAACCAATCCCCTGTTAAACCCAAACGTGAATGAAATCGAAAAATCGAACACGTATATCGTCGGTTGGCATACGAGAAATCACCGATTCGAAGTTGAAACACAGAAATACAGAAAGGGTTGGAGGTGTTGATAAGAACGGAGAAATAGCAGTAAAACGAAAAAACGTGAGC...

CDS

Download CDS FASTA

3162 bp · TkA01G442990|TK1151|CDS

ATGCACGGCAATGGAGTTATCGGAATTCTCTCAGAGTCTACAAACAAGTGGGAACGAAGGGTTCCTTTAACGCCATCACACTGTGCTCGACTTTTGCACAGTGGCAAGGGTAAAGTGGAAGTGTCGCGCATTATTGTACAGCCATCAACAAAGCGAATTCATCATGATGCTCTTTATGAGGATGTTGGCTGTGAGATTTCTGAGGATTTATCTGATTGTGGTCTCATATTGGGAATCAAGCAACCAAAGTTGGAGATGAT...

Protein

Download Protein FASTA

1053 aa · TkA01G442990|TK1151|PROTEIN

MHGNGVIGILSESTNKWERRVPLTPSHCARLLHSGKGKVEVSRIIVQPSTKRIHHDALYEDVGCEISEDLSDCGLILGIKQPKLEMILPDRAYAFFSHTHKAQIENMPLLDKILAEKASLFDYELIAGDKGKRLLAFGKFAGRAGLIDFLSGLGRRYLSLGYSTPFLSLGSSYMYPSLAAAKAAVVSVGEEIATTGLPSSISPLVFVFTGSGNVSLGAQEIFKLLPHTFVDPSKLPRLFDKGVDLCQPKRAFQVYGCVVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G442990`
TK1151 ID	TkA01G442990
OH-1004 ID	LXL04_002260
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G442990

Location Chr01:110786498-110795028 (+)

Description Similar to LKR/SDH: Alpha-aminoadipic semialdehyde synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33150`	Bifunctional enzyme that catalyzes the first two steps in lysine degradation.	A T-DNA insertion knockout of the bifunctional lysine-ketoglutarate reductase/saccharopine dehydrogenase gene elevates lysine levels in Arabidopsis seeds.2001 · DOI: 10.1104/pp.126.4.1539

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002260 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006091 generation of precursor metabolites and energy Biological Process

GO:0006554 lysine catabolic process Biological Process

GO:0019477 L-lysine catabolic process Biological Process

GO:0019878 L-lysine biosynthetic process via aminoadipic acid Biological Process

GO:0033512 L-lysine catabolic process to acetyl-CoA via L-saccharopine Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004753 saccharopine dehydrogenase activity Molecular Function

GO:0047130 saccharopine dehydrogenase (NADP+, L-lysine-forming) activity Molecular Function

GO:0047131 saccharopine dehydrogenase (NAD+, L-glutamate-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT4G33150

bta:520865

mmu:30956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · TkA01G442990 · TK1151

Nucleus0.287

Rank 2 · TkA01G442990 · TK1151

Mitochondrion0.109

Rank 3 · TkA01G442990 · TK1151

Peroxisome0.073

Rank 4 · TkA01G442990 · TK1151

Cell membrane0.050

Rank 5 · TkA01G442990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05222AlaDh_PNT_N8-143 aa

PF01262AlaDh_PNT_C292-433 aa

PF28408RNF216_N389-416 aa

PF04455Saccharop_dh_N464-532 aa

PF01262AlaDh_PNT_C571-599 aa

PF03435Sacchrp_dh_NADP574-708 aa

PF16653Sacchrp_dh_C713-1045 aa

PF05222AlaDh_PNT_N959-977 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G442990	`PF05222`	AlaDh_PNT_N	8	143	4.5e-20	73.0
TkA01G442990	`PF01262`	AlaDh_PNT_C	292	433	1.1e-05	25.6
TkA01G442990	`PF28408`	RNF216_N	389	416	0.3	11.3
TkA01G442990	`PF04455`	Saccharop_dh_N	464	532	4.2e-19	69.5
TkA01G442990	`PF01262`	AlaDh_PNT_C	571	599	1.1e-05	25.6
TkA01G442990	`PF03435`	Sacchrp_dh_NADP	574	708	5.5e-18	66.3
TkA01G442990	`PF16653`	Sacchrp_dh_C	713	1045	2.2e-80	271.1
TkA01G442990	`PF05222`	AlaDh_PNT_N	959	977	4.5e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMZ4`	Arabidopsis thaliana	sp\|Q9SMZ4\|AASS_ARATH Alpha-aminoadipic semialdehyde synthase	66.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card