TkA01G442050 | RubberDandelionOmics

Gene overview

TkA01G442050

Reference: TK1151 Chr: Chr01 Coordinates: 110554734-110557673 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · TkA01G442050|TK1151|cDNA

CTTCGATCTGTCGTCCTCAATCTGTGCAGAATCATCAGTTCTCATCGAGGTTCACGTCAATCTGGTGGGACCTCTGCAAGCATTTCTGTTAAAGTTGGGAAATCAGAGCTTAAACAAATGGTGAAACAGATGACCTTTACTGGGTCTGAGGAGTCACCTTCTGATAACTTCCTTGCTTCTAATGACACATCTGGCTTTCAAAAAACATTAATGGCTTCACGATCACGCACAACAACGATACAGAACCTTCCGGACATGAT...

CDS

Download CDS FASTA

1386 bp · TkA01G442050|TK1151|CDS

CTTCGATCTGTCGTCCTCAATCTGTGCAGAATCATCAGTTCTCATCGAGGTTCACGTCAATCTGGTGGGACCTCTGCAAGCATTTCTGTTAAAGTTGGGAAATCAGAGCTTAAACAAATGGTGAAACAGATGACCTTTACTGGGTCTGAGGAGTCACCTTCTGATAACTTCCTTGCTTCTAATGACACATCTGGCTTTCAAAAAACATTAATGGCTTCACGATCACGCACAACAACGATACAGAACCTTCCGGACATGAT...

Protein

Download Protein FASTA

461 aa · TkA01G442050|TK1151|PROTEIN

LRSVVLNLCRIISSHRGSRQSGGTSASISVKVGKSELKQMVKQMTFTGSEESPSDNFLASNDTSGFQKTLMASRSRTTTIQNLPDMILSNIFIRLFAKQLAQMRSISKSWNTLLSEPTFIKFHLHHSIYNIHQTPLHFCDDKSLHVVQLLANPHLQLTNCIKLPVHPKSQSSSLHVIGSVNGLICSSYSDSIIHIWNPSLSAVLTLPAYSMPPCWIDSEANNWLKVFFRFGYDPNTDDYKLVKLTGFADVDSSLVLWWMD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G442050`
TK1151 ID	TkA01G442050
OH-1004 ID	LXL04_002250
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.879 / OH-1004 60.136 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G442050

Location Chr01:110554734-110557673 (-)

Description Similar to At3g06240: F-box/kelch-repeat protein At3g06240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At2g17310`	Negatively regulates a plant defense signaling pathway which is independent of salicylic acid (SA) and systemic acquired resistance (SAR).	Arabidopsis SON1 is an F-box protein that regulates a novel induced defense response independent of both salicylic acid and systemic acquired resistance.2002 · DOI: 10.1105/tpc.001867
`At1g26515`	Putative F-box protein At1g26515.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002250 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA01G442050 · TK1151

Nucleus0.500

Rank 2 · TkA01G442050 · TK1151

Cell membrane0.101

Rank 3 · TkA01G442050 · TK1151

Endoplasmic reticulum0.074

Rank 4 · TkA01G442050 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA01G442050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like80-117 aa

PF00646F-box80-119 aa

PF08268FBA_3166-386 aa

PF24750b-prop_At3g26010-like166-347 aa

PF07734FBA_1169-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G442050	`PF12937`	F-box-like	80	117	3.2e-05	24.3
TkA01G442050	`PF00646`	F-box	80	119	0.0002	21.9
TkA01G442050	`PF08268`	FBA_3	166	386	4.7e-25	89.0
TkA01G442050	`PF24750`	b-prop_At3g26010-like	166	347	1.9e-07	31.3
TkA01G442050	`PF07734`	FBA_1	169	428	7.6e-21	75.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	27.800%	Swiss-Prot	Low
`Q8LL17`	Arabidopsis thaliana	sp\|Q8LL17\|SON1_ARATH Protein SUPPRESSOR OF NIM1 1	26.200%	Swiss-Prot	Low
`Q9FZD6`	Arabidopsis thaliana	sp\|Q9FZD6\|FB306_ARATH Putative F-box protein At1g26515	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card