TkA01G441750 | RubberDandelionOmics

Gene overview

TkA01G441750

Reference: TK1151 Chr: Chr01 Coordinates: 110479791-110481563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA01G441750|TK1151|cDNA

ATGACCCCAAAATCTACCTCACAGCCCCAGCAGCGAAAGAGCTTTTGCACAATGGCGGATGCGTATGGAGTTATCTTAGACTCTCCGAGCCTCCATAAGAACCTCGACGTTGTGCTCTTGGGTCATCATCACGCTAAGGATGATTGCTTTCAGTTTGATTTTAAGCTTCCCGACATTCGACGACCAATCTCTAATTTTGTAAAGACAAGAGAAGCAGGGGAATTTCTCAGTGGTGCTTTAGCTGGAGCCATGACCAAAGC...

CDS

Download CDS FASTA

1107 bp · TkA01G441750|TK1151|CDS

ATGACCCCAAAATCTACCTCACAGCCCCAGCAGCGAAAGAGCTTTTGCACAATGGCGGATGCGTATGGAGTTATCTTAGACTCTCCGAGCCTCCATAAGAACCTCGACGTTGTGCTCTTGGGTCATCATCACGCTAAGGATGATTGCTTTCAGTTTGATTTTAAGCTTCCCGACATTCGACGACCAATCTCTAATTTTGTAAAGACAAGAGAAGCAGGGGAATTTCTCAGTGGTGCTTTAGCTGGAGCCATGACCAAAGC...

Protein

Download Protein FASTA

368 aa · TkA01G441750|TK1151|PROTEIN

MTPKSTSQPQQRKSFCTMADAYGVILDSPSLHKNLDVVLLGHHHAKDDCFQFDFKLPDIRRPISNFVKTREAGEFLSGALAGAMTKAVLAPLETIRTRMVVGVGSKTISGSFLQVIEKQGWQGLWAGNAINMIRIVPTQAIELGTFECVKRVMTSAKEKFSKEDPSIQIGQVKLSFPLSWLSPVALGGAAAGFVSTLVCHPLEVLKDRLTVSPDTYPNLSIAVSKIYKSGGIGSFYAGLSPTLIGMLPYSTCYYFMYDTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G441750`
TK1151 ID	TkA01G441750
OH-1004 ID	LXL04_002245
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 97.554 / OH-1004 99.474 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G441750

Location Chr01:110479791-110481563 (-)

Description Similar to At3g20240: Probable mitochondrial adenine nucleotide transporter BTL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20240`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP.	No verified direct reference in this release
`At4g32400`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP, but not ADP-glucose.	Isolation and characterization of shs1, a sugar-hypersensitive and ABA-insensitive mutant with multiple stress responses.2007 · DOI: 10.1007/s11103-007-9219-y

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002245 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015866 ADP transport Biological Process

GO:0015867 ATP transport Biological Process

GO:0035349 coenzyme A transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080121 AMP transport Biological Process

GO:0090480 purine nucleotide-sugar transmembrane transport Biological Process

GO:1990559 mitochondrial coenzyme A transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G20240

ath:AT4G32400

xtr:780169

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.891

Rank 1 · TkA01G441750 · TK1151

Cytoplasm0.046

Rank 2 · TkA01G441750 · TK1151

Plastid0.041

Rank 3 · TkA01G441750 · TK1151

Nucleus0.029

Rank 4 · TkA01G441750 · TK1151

Cell membrane0.026

Rank 5 · TkA01G441750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr74-155 aa

PF00153Mito_carr185-265 aa

PF00153Mito_carr277-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G441750	`PF00153`	Mito_carr	74	155	8e-63	208.9
TkA01G441750	`PF00153`	Mito_carr	185	265	8e-63	208.9
TkA01G441750	`PF00153`	Mito_carr	277	363	8e-63	208.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJX5`	Arabidopsis thaliana	sp\|Q9LJX5\|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1	72.400%	Swiss-Prot	High
`Q9SUV1`	Arabidopsis thaliana	sp\|Q9SUV1\|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card