TkA01G439820 | RubberDandelionOmics

Gene overview

TkA01G439820

Reference: TK1151 Chr: Chr01 Coordinates: 109883979-109884589 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA01G439820|TK1151|cDNA

ATGGTCCCAAAAACCAATCAAAGGAAGAACACAGTCGACCCTGATTTCCTTCCACTTCCATCCTTCGAACAATGCTTCCACAAAGTCCCGTTCAGACGCGTTCATCTCTCCGGCGACGAACCGCATTTCGACACGTACGATACCAGCGGCCCGCAAATCGGACTCCCGAAGTTACGCAAAGAATGGATCGAATCCAGAGAGAAATCAAATCCGCCGAGCGTGAAGGAGATCGCCGGAGATGAGCTATCGCACGTCAGAGG...

CDS

Download CDS FASTA

432 bp · TkA01G439820|TK1151|CDS

ATGGTCCCAAAAACCAATCAAAGGAAGAACACAGTCGACCCTGATTTCCTTCCACTTCCATCCTTCGAACAATGCTTCCACAAAGTCCCGTTCAGACGCGTTCATCTCTCCGGCGACGAACCGCATTTCGACACGTACGATACCAGCGGCCCGCAAATCGGACTCCCGAAGTTACGCAAAGAATGGATCGAATCCAGAGAGAAATCAAATCCGCCGAGCGTGAAGGAGATCGCCGGAGATGAGCTATCGCACGTCAGAGG...

Protein

Download Protein FASTA

143 aa · TkA01G439820|TK1151|PROTEIN

MVPKTNQRKNTVDPDFLPLPSFEQCFHKVPFRRVHLSGDEPHFDTYDTSGPQIGLPKLRKEWIESREKSNPPSVKEIAGDELSHVRGRQRAGDRMEVEAVSAARVFQMEVLEKKVVAGYVASCFLIRGGEKPIDFMKTTTSIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G439820`
TK1151 ID	TkA01G439820
OH-1004 ID	LXL04_026967
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.100
Protein coverage (%)	TK1151 49.650 / OH-1004 15.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G439820

Location Chr01:109883979-109884589 (+)

Description Similar to THIC: Phosphomethylpyrimidine synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29630`	Catalyzes the synthesis of the hydroxymethylpyrimidine phosphate (HMP-P) moiety of thiamine from aminoimidazole ribotide (AIR) in a radical S-adenosyl-L-methionine (SAM)-dependent reaction.	Vitamin B1 biosynthesis in plants requires the essential iron sulfur cluster protein, THIC.2007 · DOI: 10.1073/pnas.0709597104 AtTHIC, a gene involved in thiamine biosynthesis in Arabidopsis thaliana.2008 · DOI: 10.1038/cr.2008.35

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026967 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009228 thiamine biosynthetic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0010266 response to vitamin B1 Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0019904 protein domain specific binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT2G29630

bcy:Bcer98_3762

bha:BH1933

pmy:Pmen_0609

psa:PST_3816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.502

Rank 1 · TkA01G439820 · TK1151

Cytoplasm0.395

Rank 2 · TkA01G439820 · TK1151

Mitochondrion0.107

Rank 3 · TkA01G439820 · TK1151

Cell membrane0.075

Rank 4 · TkA01G439820 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA01G439820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13667ThiC-associated31-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G439820	`PF13667`	ThiC-associated	31	68	0.001	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82392`	Arabidopsis thaliana	sp\|O82392\|THIC_ARATH Phosphomethylpyrimidine synthase, chloroplastic	53.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card