TkA01G437750 | RubberDandelionOmics

Gene overview

TkA01G437750

Reference: TK1151 Chr: Chr01 Coordinates: 109372589-109374711 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1864 bp · TkA01G437750|TK1151|cDNA

CGAGACAAAGACAATATCCTTATTACATTTATGGAGAGTGACTGTCCACAAAATTGCATGGCGTCGCTGCTACATAACTGAATAACAGATTCATAGAAGCGAATCTTCTACTATTTTCATCTCTTTCACACACACACAATCTCCTCCAATTTCTTCCGATTTCCTAAAAACCCAAAAGAATCCACATATCGAACAAATAAAGCAACAATCCATCACCGAAATCCCCCAAAGAAATGATCAGAATTCCGTTAAATCCATGC...

CDS

Download CDS FASTA

1497 bp · TkA01G437750|TK1151|CDS

ATGATCAGAATTCCGTTAAATCCATGCCAGTCGATCATGACAATCATACTCTGTTTCTCGACAACATTTATGGCGGTTGTCACTTGTTCTGATCCCAATTCGAATATCGGCGTGGGAATCAACTGGGGCACCATGACCAGCCACCAGTTGCCGGCGGAGAAGGTGGTGGACATGATGAGAGAGAATGGGTTCAAGAAGGTGAAGCTCTTTGAAGCAGAAAAAAGGATCATGGAAGCCCTAATTGGATCAGAGATTGAAGT...

Protein

Download Protein FASTA

498 aa · TkA01G437750|TK1151|PROTEIN

MIRIPLNPCQSIMTIILCFSTTFMAVVTCSDPNSNIGVGINWGTMTSHQLPAEKVVDMMRENGFKKVKLFEAEKRIMEALIGSEIEVMVAIPNFMLLDMSQDPSYADYWVDANITTYAYPGGVDIKYVAVGNEPFLKAYNATYLQITLPALKNVQNALHRAGFGNQIKATVPLNADIYESPASNPVPSAGDFRSEVKDATIEIIQFLYSNDAPFTVNIYPFLSLYGNAYFPMDFAFFDGSNKPLKDGNYLYTNVFDANYD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G437750`
TK1151 ID	TkA01G437750
OH-1004 ID	LXL04_002588
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.598 / OH-1004 92.884 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G437750

Location Chr01:109372589-109374711 (-)

Description Similar to At1g64760: Glucan endo-1,3-beta-glucosidase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64760`	Glucan endo-1,3-beta-glucosidase 8.	No verified direct reference in this release
`At5g58090`	Glucan endo-1,3-beta-glucosidase 6.	No verified direct reference in this release
`At4g31140`	Glucan endo-1,3-beta-glucosidase 5.	No verified direct reference in this release
`At5g58480`	Glucan endo-1,3-beta-glucosidase 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002588 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64760

ath:AT4G31140

ath:AT5G58090

ath:AT5G58480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.511

Rank 1 · TkA01G437750 · TK1151

Lysosome / Vacuole0.151

Rank 2 · TkA01G437750 · TK1151

Endoplasmic reticulum0.094

Rank 3 · TkA01G437750 · TK1151

Extracellular0.085

Rank 4 · TkA01G437750 · TK1151

Cytoplasm0.080

Rank 5 · TkA01G437750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1738-358 aa

PF29664BtgE-BtgC_glyc-hydro56-175 aa

PF26567BstA_C75-141 aa

PF29664BtgE-BtgC_glyc-hydro234-345 aa

PF26567BstA_C254-272 aa

PF07983X8381-448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G437750	`PF00332`	Glyco_hydro_17	38	358	1.5e-63	216.0
TkA01G437750	`PF29664`	BtgE-BtgC_glyc-hydro	56	175	3.9e-13	49.9
TkA01G437750	`PF26567`	BstA_C	75	141	0.066	14.1
TkA01G437750	`PF29664`	BtgE-BtgC_glyc-hydro	234	345	3.9e-13	49.9
TkA01G437750	`PF26567`	BstA_C	254	272	0.066	14.1
TkA01G437750	`PF07983`	X8	381	448	3.2e-16	60.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKW9`	Arabidopsis thaliana	sp\|Q6NKW9\|E138_ARATH Glucan endo-1,3-beta-glucosidase 8	55.000%	Swiss-Prot	High
`Q93Z08`	Arabidopsis thaliana	sp\|Q93Z08\|E136_ARATH Glucan endo-1,3-beta-glucosidase 6	53.600%	Swiss-Prot	High
`Q9M088`	Arabidopsis thaliana	sp\|Q9M088\|E135_ARATH Glucan endo-1,3-beta-glucosidase 5	53.500%	Swiss-Prot	High
`Q9FGH4`	Arabidopsis thaliana	sp\|Q9FGH4\|E139_ARATH Glucan endo-1,3-beta-glucosidase 9	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card