TkA01G434320 | RubberDandelionOmics

Gene overview

TkA01G434320

Reference: TK1151 Chr: Chr01 Coordinates: 108497073-108497438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA01G434320|TK1151|cDNA

ATGAATGATGATGGTGACATGGCGGAAATGTACCTAACCGAAAAGAAACAAAAGGATTCATGCACCGATTTATACGATCAAGTTCAAGGTGGTGGGACCGCCACCAGTAGCATTGCAACTTCAATAACGGGGCCCGTATTGGGAGTCATGTCAAAATCCGCCCCGGTTTCTCCCGTGGGGTCCGCAAGCGGGTCGCAGAGATTGCAAAGGGCGTTTAGTAATATAAGTGCACATAAACACGGAAGCTTGTTGAGTTCATC...

CDS

Download CDS FASTA

366 bp · TkA01G434320|TK1151|CDS

ATGAATGATGATGGTGACATGGCGGAAATGTACCTAACCGAAAAGAAACAAAAGGATTCATGCACCGATTTATACGATCAAGTTCAAGGTGGTGGGACCGCCACCAGTAGCATTGCAACTTCAATAACGGGGCCCGTATTGGGAGTCATGTCAAAATCCGCCCCGGTTTCTCCCGTGGGGTCCGCAAGCGGGTCGCAGAGATTGCAAAGGGCGTTTAGTAATATAAGTGCACATAAACACGGAAGCTTGTTGAGTTCATC...

Protein

Download Protein FASTA

121 aa · TkA01G434320|TK1151|PROTEIN

MNDDGDMAEMYLTEKKQKDSCTDLYDQVQGGGTATSSIATSITGPVLGVMSKSAPVSPVGSASGSQRLQRAFSNISAHKHGSLLSSSVTGETENIDQLEMLLEAYFVGIDNTLNKLLSVRQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G434320`
TK1151 ID	TkA01G434320
OH-1004 ID	LXL04_038815
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G434320

Location Chr01:108497073-108497438 (-)

Description Similar to MRS2-B: Magnesium transporter MRS2-B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03620`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`At1g16010`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`At1g80900`	High-affinity magnesium transporter that mediates the influx of magnesium.	A novel family of magnesium transport genes in Arabidopsis.2001 · DOI: 10.1105/tpc.010352 Overexpression of an Arabidopsis magnesium transport gene, AtMGT1, in Nicotiana benthamiana confers Al tolerance.2006 · DOI: 10.1093/jxb/erl201

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFN7`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`Os06g0650800`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038815 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015693 magnesium ion transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015095 magnesium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G16010

ath:AT1G80900

ath:AT2G03620

dosa:Os06g0650800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.507

Rank 1 · TkA01G434320 · TK1151

Nucleus0.339

Rank 2 · TkA01G434320 · TK1151

Cell membrane0.139

Rank 3 · TkA01G434320 · TK1151

Mitochondrion0.090

Rank 4 · TkA01G434320 · TK1151

Golgi apparatus0.070

Rank 5 · TkA01G434320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22099MRS2-like1-19 aa

PF22099MRS2-like91-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G434320	`PF22099`	MRS2-like	1	19	0.00036	20.5
TkA01G434320	`PF22099`	MRS2-like	91	117	0.00036	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPR4`	Arabidopsis thaliana	sp\|Q9ZPR4\|MRS25_ARATH Magnesium transporter MRS2-5	56.000%	Swiss-Prot	High
`Q9S9N4`	Arabidopsis thaliana	sp\|Q9S9N4\|MRS21_ARATH Magnesium transporter MRS2-1	47.100%	Swiss-Prot	Medium
`Q9SAH0`	Arabidopsis thaliana	sp\|Q9SAH0\|MRS2A_ARATH Magnesium transporter MRS2-10	47.100%	Swiss-Prot	Medium
`A2YFN7`	Oryza sativa subsp. indica	sp\|A2YFN7\|MRS2B_ORYSI Magnesium transporter MRS2-B	47.900%	Swiss-Prot	Medium
`Q67UQ7`	Oryza sativa subsp. japonica	sp\|Q67UQ7\|MRS2B_ORYSJ Magnesium transporter MRS2-B	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card