TkA01G430540 | RubberDandelionOmics

Gene overview

TkA01G430540

Reference: TK1151 Chr: Chr01 Coordinates: 107550462-107552823 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1273 bp · TkA01G430540|TK1151|cDNA

ATTCCCATCCAAGAAAGAAGTAGCGTCAACTTCAAGCCACCACCGTCATTCTCTCTCTTCCGGGAGAATAAAACCGGAAATATTCTCCAGAATATGCCTTTCCTTTCCTCCGCATATTCTCCCCCCTTCTAACTTATATTCCTCCTCCCTCTCCCGTACTCGTCCTCCGCCTACTCCGCATTAACTTCTCTCTAACAAATCGAAACTCATTCAACAACAATCATGAAGTTCGGAAAGAGTTTAAGCTATCAAATCGAGGA...

CDS

Download CDS FASTA

846 bp · TkA01G430540|TK1151|CDS

ATGAAGTTCGGAAAGAGTTTAAGCTATCAAATCGAGGAAACTTTGCCTGAATGGAGAGACAAGTTCTTGTCTTACAAAGAACTGAAGAAACGATTGAAGCTTATCAAACCACAAGACAAATCCGGTGATGACTGTAACAGACCGGCGAAGCGGACTCGTTTTTCCTGCGAAGACTGTACGATTGCTGGTGGTGAAGAGATGTCGAGCGAAGAAGTTGATTTCGTTGAATTGCTGGAACAGGAAGTCGAGAAATTCAATTC...

Protein

Download Protein FASTA

281 aa · TkA01G430540|TK1151|PROTEIN

MKFGKSLSYQIEETLPEWRDKFLSYKELKKRLKLIKPQDKSGDDCNRPAKRTRFSCEDCTIAGGEEMSSEEVDFVELLEQEVEKFNSFFVEKEEEYIIKLKELQDSVMKSKDSNEEMIKIRKEIVDFHGEMVLLENYSALNYTGIVKILKKYDKRTGALLRLPFIQKVLQQPFFTTDLLYKLVKECEAMLDRHFPLTDGGGGGDEPTTSGAASEGPLKAKELAELEYMKSLYTKSTISALRSLKEIRSKSSTVSVFSLPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G430540`
TK1151 ID	TkA01G430540
OH-1004 ID	LXL04_002680
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G430540

Location Chr01:107550462-107552823 (+)

Description Similar to SPX1: SPX domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26660`	May inhibit PHR1 DNA-binding activity in a Pi-dependent manner.	SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis.2014 · DOI: 10.1073/pnas.1404654111
`At5g20150`	Plays a positive role in plant adaptation to phosphate starvation.	Characterization of a sub-family of Arabidopsis genes with the SPX domain reveals their diverse functions in plant tolerance to phosphorus starvation.2008 · DOI: 10.1111/j.1365-313x.2008.03460.x SPX1 is a phosphate-dependent inhibitor of Phosphate Starvation Response 1 in Arabidopsis.2014 · DOI: 10.1073/pnas.1404654111

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B4D0`	Involved in plant adaptation to phosphate (Pi) starvation (By similarity).	No verified direct reference in this release
`Os06g0603600`	Involved in plant adaptation to phosphate (Pi) starvation.	Involvement of OsSPX1 in phosphate homeostasis in rice.2009 · DOI: 10.1111/j.1365-313x.2008.03734.x Regulation of OsSPX1 and OsSPX3 on expression of OsSPX domain genes and Pi-starvation signaling in rice.2009 · DOI: 10.1111/j.1744-7909.2009.00834.x OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice.2010 · DOI: 10.1111/j.1365-313x.2010.04170.x Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner.2014 · DOI: 10.1073/pnas.1404680111 An SPX-RLI1 Module Regulates Leaf Inclination in Response to Phosphate Availability in Rice.2018 · DOI: 10.1105/tpc.17.00738
`UniProt: A2X254`	Inhibits PHR2 DNA-binding activity via a phosphate (Pi)-dependent protein interaction (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0051511 negative regulation of unidimensional cell growth Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080040 positive regulation of cellular response to phosphate starvation Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G26660

ath:AT5G20150

dosa:Os02g0202200

dosa:Os06g0603600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.625

Rank 1 · TkA01G430540 · TK1151

Cytoplasm0.354

Rank 2 · TkA01G430540 · TK1151

Cell membrane0.159

Rank 3 · TkA01G430540 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA01G430540 · TK1151

Lysosome / Vacuole0.043

Rank 5 · TkA01G430540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105SPX1-37 aa

PF05093CIAPIN143-94 aa

PF03105SPX66-112 aa

PF03105SPX116-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G430540	`PF03105`	SPX	1	37	2.5e-25	91.0
TkA01G430540	`PF05093`	CIAPIN1	43	94	0.22	12.8
TkA01G430540	`PF03105`	SPX	66	112	2.5e-25	91.0
TkA01G430540	`PF03105`	SPX	116	168	2.5e-25	91.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48781`	Arabidopsis thaliana	sp\|O48781\|SPX2_ARATH SPX domain-containing protein 2	66.300%	Swiss-Prot	High
`Q8LBH4`	Arabidopsis thaliana	sp\|Q8LBH4\|SPX1_ARATH SPX domain-containing protein 1	65.500%	Swiss-Prot	High
`B8B4D0`	Oryza sativa subsp. indica	sp\|B8B4D0\|SPX1_ORYSI SPX domain-containing protein 1	59.600%	Swiss-Prot	High
`Q69XJ0`	Oryza sativa subsp. japonica	sp\|Q69XJ0\|SPX1_ORYSJ SPX domain-containing protein 1	59.600%	Swiss-Prot	High
`A2X254`	Oryza sativa subsp. indica	sp\|A2X254\|SPX2_ORYSI SPX domain-containing protein 2	54.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card