Gene Card
Gene overview
cDNA / CDS / Protein Sequences
906 bp · TkA01G429020|TK1151|cDNA
ATGGAGAATTTGAAGAACAACCCAGATGAAAAAGAACCGAAAGACACATACAATATAGCTTATATAATCCATTTCTTGCTTGGGGCCGGGAATTTACTTCCATGGAATGCTTTAATCACAGCCATCGATTACTTTGGTCATCGTTATCCGGACAAACACGTGGAAAAAGTGTTTTCGGTAGCTTATATGAGCTCATCACTTTTAGTTTTGATTGTTATGATAAGTTGGAGTAATTTTAGCAAAATCTTTTCGTTTCAAGT...
906 bp · TkA01G429020|TK1151|CDS
ATGGAGAATTTGAAGAACAACCCAGATGAAAAAGAACCGAAAGACACATACAATATAGCTTATATAATCCATTTCTTGCTTGGGGCCGGGAATTTACTTCCATGGAATGCTTTAATCACAGCCATCGATTACTTTGGTCATCGTTATCCGGACAAACACGTGGAAAAAGTGTTTTCGGTAGCTTATATGAGCTCATCACTTTTAGTTTTGATTGTTATGATAAGTTGGAGTAATTTTAGCAAAATCTTTTCGTTTCAAGT...
Protein
Download Protein FASTA301 aa · TkA01G429020|TK1151|PROTEIN
MENLKNNPDEKEPKDTYNIAYIIHFLLGAGNLLPWNALITAIDYFGHRYPDKHVEKVFSVAYMSSSLLVLIVMISWSNFSKIFSFQVRMKIGFTMFVVSLMVTPTIDWAWEGLQNEKTLNATFNTVVASVVMCGLADGLIGGSLVGSAGKLPKQYMQAVFAGTGSSACLHGPKWLRNEVFVIFLTVVLGFTNGYLTSVIMIMAPKLVSTSESEMAAIVMALFLGLGLVFGSVLGCNHFNGSYLGGEFNQSQGVHSLREQA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G429020 |
|---|---|
| TK1151 ID | TkA01G429020 |
| OH-1004 ID | LXL04_028055 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 43.400 |
| Protein coverage (%) | TK1151 77.741 / OH-1004 98.731Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G429020 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:107092170-107096764 (+) | |||||||||
| Description | Similar to ETN8: Equilibrative nucleotide transporter 8 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0015858 nucleoside transport Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005337 nucleoside transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G02630 ath:AT1G61630 ath:AT1G70330 ath:AT3G09990 ath:AT4G05130 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07690MFS_121-161 aaPF17461DUF542350-144 aaPF01733Nucleoside_tran67-82 aaPF09489CbtB126-135 aaPF01733Nucleoside_tran128-166 aaPF07690MFS_1161-234 aaPF01733Nucleoside_tran172-233 aaPF09489CbtB207-232 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G429020 | PF07690 | MFS_1 | 21 | 161 | 0.0021 | 17.7 |
| TkA01G429020 | PF17461 | DUF5423 | 50 | 144 | 0.033 | 13.8 |
| TkA01G429020 | PF01733 | Nucleoside_tran | 67 | 82 | 1.5e-20 | 74.5 |
| TkA01G429020 | PF09489 | CbtB | 126 | 135 | 0.49 | 11.3 |
| TkA01G429020 | PF01733 | Nucleoside_tran | 128 | 166 | 1.5e-20 | 74.5 |
| TkA01G429020 | PF07690 | MFS_1 | 161 | 234 | 0.0021 | 17.7 |
| TkA01G429020 | PF01733 | Nucleoside_tran | 172 | 233 | 1.5e-20 | 74.5 |
| TkA01G429020 | PF09489 | CbtB | 207 | 232 | 0.49 | 11.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.