TkA01G426900 | RubberDandelionOmics

Gene overview

TkA01G426900

Reference: TK1151 Chr: Chr01 Coordinates: 106586466-106589477 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2436 bp · TkA01G426900|TK1151|cDNA

GAAATAACGGTTTTGGGTGAAAAAGTCAAGCATGCAGGGAGGTTTTAAGTAGTTCAAGAAAACTATAAGGGGGCGAATTGAAAAAGTTTAGGATGTTTAAAAAAAAGGAACACTCGTCATGCCACTCATACATAAAGTTGCCCATACATGACACATTCTTCATTTTTGGTTTTGTAAAGCGTTCACTTTTCTCGTAGATCGGAGCTTCTTCCACCATTCTTAAATCGAGCATATAATTCCCTGAGAATTGTCGACTTACT...

CDS

Download CDS FASTA

1677 bp · TkA01G426900|TK1151|CDS

ATGTCTTCAAGCACTATCAGAAAGGCGATTGGGGTGGTTAAAGACCAAACTAGTATAAGCATCGCCAAAGTTGCAGGCAATGTAGCACCAGGTCTCGAGGTACTCATAGTGAAAGCAACAGGCCATGACATTGAGCCTGCTGAAGAAAGGTACATAAGAGAAATCCTTCACCTCATATCTCAAAATCGAGGATACGTAAGCGCATGCGTCTACAACATCTCAAAACGGTTGAACAAAACAAGCGATTGGGTCGTGGCATT...

Protein

Download Protein FASTA

558 aa · TkA01G426900|TK1151|PROTEIN

MSSSTIRKAIGVVKDQTSISIAKVAGNVAPGLEVLIVKATGHDIEPAEERYIREILHLISQNRGYVSACVYNISKRLNKTSDWVVALKALMLVHRLLVDGSPIFGQEIMFASRKGSRVLNMSDFRVEALSNYWDHAAFVKNYALYLDQKLEFIAFERKLSGFKDKWRCEGRYGGFRDDHSYGISYKSKSYGDLHESTLSKETNVGTSLKEMKDDRVLERLSKLLRVINRGVLCRPAGTAKTNKMILVALYLVLHESFRVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G426900`
TK1151 ID	TkA01G426900
OH-1004 ID	LXL04_002707
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 31.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G426900

Location Chr01:106586466-106589477 (+)

Description Similar to TPR4: Topless-related protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32285`	Probable clathrin assembly protein At4g32285.	No verified direct reference in this release
`At2g25430`	Putative clathrin assembly protein At2g25430.	No verified direct reference in this release
`At1g03050`	Putative clathrin assembly protein At1g03050.	No verified direct reference in this release
`At4g02650`	Putative clathrin assembly protein At4g02650.	No verified direct reference in this release
`At1g05020`	Adaptins are components of the adapter complexes which link clathrin to receptors in coated vesicles.	Identification and functional characterization of Arabidopsis AP180, a binding partner of plant alphaC-adaptin.2004 · DOI: 10.1242/jcs.01062

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G15750

ath:AT1G80490

ath:AT3G15880

dosa:Os03g0254700

dosa:Os08g0162100

osa:4332285

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.508

Rank 1 · TkA01G426900 · TK1151

Cytoplasm0.367

Rank 2 · TkA01G426900 · TK1151

Nucleus0.209

Rank 3 · TkA01G426900 · TK1151

Golgi apparatus0.070

Rank 4 · TkA01G426900 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA01G426900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31122FilR1_N2-15 aa

PF07651ANTH32-336 aa

PF00790VHS32-103 aa

PF01417ENTH33-143 aa

PF31122FilR1_N186-232 aa

PF01417ENTH249-301 aa

PF24743DUF7692294-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G426900	`PF31122`	FilR1_N	2	15	0.49	11.2
TkA01G426900	`PF07651`	ANTH	32	336	9.1e-64	215.8
TkA01G426900	`PF00790`	VHS	32	103	0.12	12.9
TkA01G426900	`PF01417`	ENTH	33	143	0.00059	20.6
TkA01G426900	`PF31122`	FilR1_N	186	232	0.49	11.2
TkA01G426900	`PF01417`	ENTH	249	301	0.00059	20.6
TkA01G426900	`PF24743`	DUF7692	294	319	0.32	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S9J8`	Arabidopsis thaliana	sp\|Q8S9J8\|CAP1_ARATH Probable clathrin assembly protein At4g32285	45.300%	Swiss-Prot	Medium
`Q8LF20`	Arabidopsis thaliana	sp\|Q8LF20\|CAP2_ARATH Putative clathrin assembly protein At2g25430	44.800%	Swiss-Prot	Medium
`Q9SA65`	Arabidopsis thaliana	sp\|Q9SA65\|CAP4_ARATH Putative clathrin assembly protein At1g03050	36.200%	Swiss-Prot	Medium
`Q8GX47`	Arabidopsis thaliana	sp\|Q8GX47\|CAP3_ARATH Putative clathrin assembly protein At4g02650	35.000%	Swiss-Prot	Medium
`Q9ZVN6`	Arabidopsis thaliana	sp\|Q9ZVN6\|AP180_ARATH Clathrin coat assembly protein AP180	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card