TkA01G422130 | RubberDandelionOmics

Gene overview

TkA01G422130

Reference: TK1151 Chr: Chr01 Coordinates: 105413103-105416581 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · TkA01G422130|TK1151|cDNA

ATGCCCGCATCGTGGACCGAAGAAGAGAAGGAGATGAAAGATCTTAAGGCTCTGTCCCAAATTCGTTTGCACTTGTCAAACGATGCCTTGGATTCAAAAGAGAAGATGAAGCATATTACCGGTAGTCGTGATGCTAGTGCCGAAGGCTTACAAGCCAGAGGTTATAAAGCATCAGACAGAGGAAGATATCCTCAATCTTCCAGTGAGGTCAATTCCAAGTCAGAAGGCAGGCGTAAGTTCTGCAATTATTGTCAAAAGAA...

CDS

Download CDS FASTA

615 bp · TkA01G422130|TK1151|CDS

ATGCCCGCATCGTGGACCGAAGAAGAGAAGGAGATGAAAGATCTTAAGGCTCTGTCCCAAATTCGTTTGCACTTGTCAAACGATGCCTTGGATTCAAAAGAGAAGATGAAGCATATTACCGGTAGTCGTGATGCTAGTGCCGAAGGCTTACAAGCCAGAGGTTATAAAGCATCAGACAGAGGAAGATATCCTCAATCTTCCAGTGAGGTCAATTCCAAGTCAGAAGGCAGGCGTAAGTTCTGCAATTATTGTCAAAAGAA...

Protein

Download Protein FASTA

204 aa · TkA01G422130|TK1151|PROTEIN

MPASWTEEEKEMKDLKALSQIRLHLSNDALDSKEKMKHITGSRDASAEGLQARGYKASDRGRYPQSSSEVNSKSEGRRKFCNYCQKKGHEIENCFKLRNKIAEKDKLDGHNQASASGESDVAERMLGRRKVGCFVEDISECDYSTLGLISECDYSTLGLISECDYSTLGLISECDYSTLGFINEARIAEKIRGVHNCTNEQWRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G422130`
TK1151 ID	TkA01G422130
OH-1004 ID	LXL04_019173
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.500
Protein coverage (%)	TK1151 61.765 / OH-1004 6.176 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G422130`
Location	Chr01:105413103-105416581 (+)
Description	Similar to FER: Receptor-like protein kinase FERONIA
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019173` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009723 response to ethylene Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0009791 post-embryonic development Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0010038 response to metal ion Biological Process GO:0010118 stomatal movement Biological Process GO:0010483 pollen tube reception Biological Process GO:0030308 negative regulation of cell growth Biological Process GO:0032922 circadian regulation of gene expression Biological Process
KEGG gene cross-reference	ath:AT3G51550 ath:AT5G39000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · TkA01G422130 · TK1151

Nucleus0.389

Rank 2 · TkA01G422130 · TK1151

Mitochondrion0.090

Rank 3 · TkA01G422130 · TK1151

Cell membrane0.081

Rank 4 · TkA01G422130 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA01G422130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30011EXP113-31 aa

PF30011EXP169-151 aa

PF27939DUF836374-100 aa

PF16641CLIP1_ZNF78-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G422130	`PF30011`	EXP1	13	31	0.13	13.3
TkA01G422130	`PF30011`	EXP1	69	151	0.13	13.3
TkA01G422130	`PF27939`	DUF8363	74	100	0.038	14.5
TkA01G422130	`PF16641`	CLIP1_ZNF	78	94	0.016	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card