TkA01G417320 | RubberDandelionOmics

Gene overview

TkA01G417320

Reference: TK1151 Chr: Chr01 Coordinates: 104174950-104186772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4291 bp · TkA01G417320|TK1151|cDNA

GTGGATGTAAGAATCCGTCTTTCAATACTTCCATTCTACCATATCCGTCTTCCATTTTTTGACAACCGGAACACTCCAAACTTCCTCTAATCATCTCGATTCCATCCATTTGGGTACGATTTCGGTAAATATGATTCATTGACGAGCTGTCCGTCAGTGACCCAGACGGTGAACGGCTCTTACCAGTTTGTTATTCGGAAAACACATCGACACTGATAATTTCAAGGTGGGATGGTAGTAATGGGCTGTATACTTCTACC...

CDS

Download CDS FASTA

3096 bp · TkA01G417320|TK1151|CDS

ATGAGTTCAACTGAAAGCGTAATACAAAGGGGAAAACTTCTAGTTCACATAGCAGAAAACGGGCATTCATTTGAGCTTGATTGTGATGAAGACACCCTCGTTGAATCAATCCAACAGTACTTAGAATCTCTATCTGGAATCCGCTTACACGATCAGCTAATCCTCTATCTGGATTTAAAACTAGAACCTCAACAGCCACTCTCATCCTACAAACTCCCATCAGATGATCGAGAGGTTTTCTTATTCAATCGAGCCAAAAT...

Protein

Download Protein FASTA

1031 aa · TkA01G417320|TK1151|PROTEIN

MSSTESVIQRGKLLVHIAENGHSFELDCDEDTLVESIQQYLESLSGIRLHDQLILYLDLKLEPQQPLSSYKLPSDDREVFLFNRAKMRTNSPPPNPEEQDLELSQNYHIDPPRPSSSHDPHPLDEASDPALKALPSYERQFRYHYQLGDAIYHRTLLKYQTCERLSREQRVQEKALEIARGNLDHFYKMILQNYTDFVKCYSQQQRTHSNLLVNFGRDLERLRSIKLLPVLQSGDRKCLLDFVKEDNLRKMVDDCSNSHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417320`
TK1151 ID	TkA01G417320
OH-1004 ID	LXL04_002843
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417320

Location Chr01:104174950-104186772 (+)

Description Similar to ATG11: Autophagy-related protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30790`	Accessory protein involved in autophagy.	AUTOPHAGY-RELATED11 plays a critical role in general autophagy- and senescence-induced mitophagy in Arabidopsis.2014 · DOI: 10.1105/tpc.113.120014

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002843 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015031 protein transport Biological Process

GO:0034517 ribophagy Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0061709 reticulophagy Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005776 autophagosome Cellular Component

KEGG gene cross-reference

ath:AT4G30790

mgr:MGG_04486

ncr:NCU09998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.616

Rank 1 · TkA01G417320 · TK1151

Golgi apparatus0.231

Rank 2 · TkA01G417320 · TK1151

Nucleus0.197

Rank 3 · TkA01G417320 · TK1151

Cell membrane0.137

Rank 4 · TkA01G417320 · TK1151

Lysosome / Vacuole0.127

Rank 5 · TkA01G417320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin19-75 aa

PF04108ATG17_like153-486 aa

PF28533DUF8429174-196 aa

PF28533DUF8429281-281 aa

PF00240ubiquitin296-317 aa

PF10377ATG11363-405 aa

PF07195FliD_C378-404 aa

PF178374PPT_N473-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417320	`PF00240`	ubiquitin	19	75	0.0028	18.1
TkA01G417320	`PF04108`	ATG17_like	153	486	2e-30	107.2
TkA01G417320	`PF28533`	DUF8429	174	196	0.013	16.1
TkA01G417320	`PF28533`	DUF8429	281	281	0.013	16.1
TkA01G417320	`PF00240`	ubiquitin	296	317	0.0028	18.1
TkA01G417320	`PF10377`	ATG11	363	405	8.4e-22	78.4
TkA01G417320	`PF07195`	FliD_C	378	404	2.9	7.9
TkA01G417320	`PF17837`	4PPT_N	473	501	0.11	13.4
TkA01G417320	`PF07195`	FliD_C	566	658	2.9	7.9
TkA01G417320	`PF12939`	DUF3837	566	649	4.6	8.4
TkA01G417320	`PF11932`	DUF3450	627	652	7.3	6.5
TkA01G417320	`PF28533`	DUF8429	644	658	0.013	16.1
TkA01G417320	`PF11932`	DUF3450	721	780	7.3	6.5
TkA01G417320	`PF12939`	DUF3837	724	748	4.6	8.4
TkA01G417320	`PF28533`	DUF8429	743	755	0.013	16.1
TkA01G417320	`PF12179`	IKKbetaNEMObind	759	783	0.027	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUG7`	Arabidopsis thaliana	sp\|Q9SUG7\|ATG11_ARATH Autophagy-related protein 11	54.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card