TkA01G417060 | RubberDandelionOmics

Gene overview

TkA01G417060

Reference: TK1151 Chr: Chr01 Coordinates: 104099570-104100280 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA01G417060|TK1151|cDNA

ATGAAACCAGGAAGCAACATTATAAACACCACTTCAGTGTTAGGGTTCTCAGGCAGCCCAAAGTTCATTGATTACGCCGCAACAAAGGGAGCCATCAGGAACATGACCATAAGTTTAGCAATATACGTTCTTGACAAGGGAATTCGTGTTAATGGTGTGGCCCCTGGTCCCATCTGGACCCCACTTGAAGCTGCAGCACTCGATGATGAGGATATAGCAACCTTTGGTGCACAAGTACCCCTTAATAGAGCAGGTCAACC...

CDS

Download CDS FASTA

402 bp · TkA01G417060|TK1151|CDS

ATGAAACCAGGAAGCAACATTATAAACACCACTTCAGTGTTAGGGTTCTCAGGCAGCCCAAAGTTCATTGATTACGCCGCAACAAAGGGAGCCATCAGGAACATGACCATAAGTTTAGCAATATACGTTCTTGACAAGGGAATTCGTGTTAATGGTGTGGCCCCTGGTCCCATCTGGACCCCACTTGAAGCTGCAGCACTCGATGATGAGGATATAGCAACCTTTGGTGCACAAGTACCCCTTAATAGAGCAGGTCAACC...

Protein

Download Protein FASTA

133 aa · TkA01G417060|TK1151|PROTEIN

MKPGSNIINTTSVLGFSGSPKFIDYAATKGAIRNMTISLAIYVLDKGIRVNGVAPGPIWTPLEAAALDDEDIATFGAQVPLNRAGQPFEIGKTYVFLASDDASYYTGTFLHPDGGELANSAIPRVNNSNTQNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G417060`
TK1151 ID	TkA01G417060
OH-1004 ID	LXL04_002844
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.600
Protein coverage (%)	TK1151 99.248 / OH-1004 36.389 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G417060

Location Chr01:104099570-104100280 (-)

Description Similar to CAISE5: Glucose and ribitol dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54870`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	NADPH-dependent reductases involved in the detoxification of reactive carbonyls in plants.2011 · DOI: 10.1074/jbc.m110.202226
`At3g05260`	May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0140800`	May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008206 bile acid metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

KEGG gene cross-reference

ath:AT1G54870

ath:AT3G05260

bsu:BSU09450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.634

Rank 1 · TkA01G417060 · TK1151

Nucleus0.340

Rank 2 · TkA01G417060 · TK1151

Peroxisome0.145

Rank 3 · TkA01G417060 · TK1151

Plastid0.064

Rank 4 · TkA01G417060 · TK1151

Mitochondrion0.054

Rank 5 · TkA01G417060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13561adh_short_C21-115 aa

PF23441SDR3-115 aa

PF00106adh_short4-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G417060	`PF13561`	adh_short_C2	1	115	2.1e-28	100.3
TkA01G417060	`PF23441`	SDR	3	115	0.046	13.8
TkA01G417060	`PF00106`	adh_short	4	69	6.6e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ42`	Arabidopsis thaliana	sp\|Q9FZ42\|ADRC1_ARATH NADPH-dependent aldehyde reductase 1, chloroplastic	56.200%	Swiss-Prot	High
`Q9MA93`	Arabidopsis thaliana	sp\|Q9MA93\|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2	53.700%	Swiss-Prot	High
`Q75KH3`	Oryza sativa subsp. japonica	sp\|Q75KH3\|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card