RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G415360
Reference: TK1151 Chr: Chr01 Coordinates: 103658027-103658982 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

882 bp · TkA01G415360|TK1151|cDNA

CTGGGAGACAAGACTTCGTTCCTCTGCTCAAATCCGTCGTGCTACGGGATATCCGTACTTGTCACCGGAGCAGCCGGTTTCATCGGCACACACGTATCCATAGCTTTGAAAACCCGTGGAGATGGCGTCGTCGGGGTTGACAACTTCGATGATTACTACGCCCTGTCATTGAAAGAAACCCGGCGGGAGTTGCTAGAATTTCACGGCGTTTTCATAGTTGACGGTGATATCAACGACCGTGGCCTTTTAGACATCCTCTT...

CDS

Download CDS FASTA

882 bp · TkA01G415360|TK1151|CDS

CTGGGAGACAAGACTTCGTTCCTCTGCTCAAATCCGTCGTGCTACGGGATATCCGTACTTGTCACCGGAGCAGCCGGTTTCATCGGCACACACGTATCCATAGCTTTGAAAACCCGTGGAGATGGCGTCGTCGGGGTTGACAACTTCGATGATTACTACGCCCTGTCATTGAAAGAAACCCGGCGGGAGTTGCTAGAATTTCACGGCGTTTTCATAGTTGACGGTGATATCAACGACCGTGGCCTTTTAGACATCCTCTT...

Protein

Download Protein FASTA

293 aa · TkA01G415360|TK1151|PROTEIN

LGDKTSFLCSNPSCYGISVLVTGAAGFIGTHVSIALKTRGDGVVGVDNFDDYYALSLKETRRELLEFHGVFIVDGDINDRGLLDILFDTIAFTHVMHLAAQVGVQYAVENPYAYVHSNIASMVTLLERCKSADPQPAIVWASSGSVYGVKSKQQNTFFRIRPGRSTVSIYASTKRNGEEITQTYNRFYGLSITGLGKPITMYRANHTNSARDFIYIDDVVKGCVASLDTSGKSVGLGNGSGPYRIYNLGSASPVTVPTLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G415360
TK1151 IDTkA01G415360
OH-1004 IDLXL04_002870
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)85.800
Protein coverage (%)TK1151 92.150 / OH-1004 73.566
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G415360
LocationChr01:103658027-103658982 (-)
DescriptionSimilar to GAE1: UDP-glucuronate 4-epimerase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g30440 UDP-D-glucuronate 4-epimerase involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.
The biosynthesis of D-Galacturonate in plants. functional cloning and characterization of a membrane-anchored UDP-D-Glucuronate 4-epimerase from Arabidopsis.2004 · DOI: 10.1104/pp.104.043745
At1g02000 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At2g45310 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At4g00110 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components. No verified direct reference in this release
At3g23820 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.
Identification and characterization of a UDP-D-glucuronate 4-epimerase in Arabidopsis.2004 · DOI: 10.1016/j.febslet.2004.06.005

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002870 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0033481 galacturonate biosynthetic process Biological Process
GO:0050829 defense response to Gram-negative bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0016020 membrane Cellular Component
GO:0032580 Golgi cisterna membrane Cellular Component
GO:0016854 racemase and epimerase activity Molecular Function
GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function
KEGG gene cross-reference
ath:AT1G02000
ath:AT2G45310
ath:AT3G23820
ath:AT4G00110
ath:AT4G30440
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.480
Rank 1 · TkA01G415360 · TK1151
Nucleus0.237
Rank 2 · TkA01G415360 · TK1151
Peroxisome0.146
Rank 3 · TkA01G415360 · TK1151
Plastid0.104
Rank 4 · TkA01G415360 · TK1151
Mitochondrion0.087
Rank 5 · TkA01G415360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase19-195 aa
PF04321RmlD_sub_bind19-185 aa
PF02719Polysacc_synt_219-135 aa
PF00106adh_short19-128 aa
PF16363GDP_Man_Dehyd20-192 aa
PF010733Beta_HSD20-182 aa
PF07993NAD_binding_421-32 aa
PF07993NAD_binding_470-186 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G415360PF01370Epimerase191951.1e-35123.9
TkA01G415360PF04321RmlD_sub_bind191853.7e-0730.2
TkA01G415360PF02719Polysacc_synt_2191356.9e-0729.5
TkA01G415360PF00106adh_short191280.005217.0
TkA01G415360PF16363GDP_Man_Dehyd201922e-29103.8
TkA01G415360PF010733Beta_HSD201825e-0729.8
TkA01G415360PF07993NAD_binding_421320.0001321.9
TkA01G415360PF07993NAD_binding_4701860.0001321.9
TkA01G415360PF02719Polysacc_synt_21671866.9e-0729.5
TkA01G415360PF01370Epimerase1962321.1e-35123.9
TkA01G415360PF010733Beta_HSD2002215e-0729.8
TkA01G415360PF16363GDP_Man_Dehyd2052282e-29103.8
TkA01G415360PF16363GDP_Man_Dehyd2422602e-29103.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M0B6Arabidopsis thalianasp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 156.200%Swiss-ProtHigh
Q9LPC1Arabidopsis thalianasp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 254.000%Swiss-ProtHigh
O22141Arabidopsis thalianasp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 455.700%Swiss-ProtHigh
O81312Arabidopsis thalianasp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 354.700%Swiss-ProtHigh
Q9LIS3Arabidopsis thalianasp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 652.300%Swiss-ProtHigh

JBrowse

View in Genome Browser