TkA01G415310 | RubberDandelionOmics

Gene overview

TkA01G415310

Reference: TK1151 Chr: Chr01 Coordinates: 103634328-103636986 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

928 bp · TkA01G415310|TK1151|cDNA

ACCCGATTACTCTCTGAATTTCGGTTTCACCGACCCGTTCTCTCCTTTCGTCTCTTCCGGCGCGTATATACTGATATACTGATAAGCCTTCAAGTAGTTGTTCATGTGAAGAAGGAGCAAACGAGTGACCCAACTTGAGATCTAATGGGTAACTGTCTGCCAATGGAAGATTTAAGTAAGCTATTTCGGCCTCGCCGGGATGAGTTTCTCAAACTATCTCAAGACGACAAACTCTGGGCATTCCTTGCAACGTTTCCAAC...

CDS

Download CDS FASTA

402 bp · TkA01G415310|TK1151|CDS

ATGAGTTTCTCAAACTATCTCAAGACGACAAACTCTGGGCATTCCTTGCAACGTTTCCAACTAAACTTCAATATACGAAACCTCAGTTCTACTTCATATTATGGGTTTTTTGGAGTCAACAAGCAGTATCTCGAAACAATTCATCTTCAAGTGAGTCTCCTTCATATTCAATTTCAGATTGAACTGAAGACTGCACCAGGTGACTATCGTTTCCCAACAACAAATCAAAGCCGACACTGTTTCACTCGCTACATAGAGTT...

Protein

Download Protein FASTA

133 aa · TkA01G415310|TK1151|PROTEIN

MSFSNYLKTTNSGHSLQRFQLNFNIRNLSSTSYYGFFGVNKQYLETIHLQVSLLHIQFQIELKTAPGDYRFPTTNQSRHCFTRYIEFHRCVAAKGDGAGECEKFAKYYRSLCPAEWVDRWNEQRENGVFPGPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G415310`
TK1151 ID	TkA01G415310
OH-1004 ID	LXL04_002873
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G415310

Location Chr01:103634328-103636986 (-)

Description Similar to COX6B-1: Cytochrome c oxidase subunit 6b-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22450`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At4g28060`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At5g57815`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002873 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006119 oxidative phosphorylation Biological Process

GO:0006123 mitochondrial electron transport, cytochrome c to oxygen Biological Process

GO:0045333 cellular respiration Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT1G22450

ath:AT4G28060

ath:AT5G57815

pon:100172105

spo:2538835

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.665

Rank 1 · TkA01G415310 · TK1151

Cytoplasm0.164

Rank 2 · TkA01G415310 · TK1151

Nucleus0.090

Rank 3 · TkA01G415310 · TK1151

Plastid0.090

Rank 4 · TkA01G415310 · TK1151

Peroxisome0.068

Rank 5 · TkA01G415310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02297COX6B70-130 aa

PF16860CX9C77-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G415310	`PF02297`	COX6B	70	130	5.9e-21	75.1
TkA01G415310	`PF16860`	CX9C	77	103	0.22	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7L9`	Arabidopsis thaliana	sp\|Q9S7L9\|CX6B1_ARATH Cytochrome c oxidase subunit 6b-1	81.300%	Swiss-Prot	Medium
`Q9SUD3`	Arabidopsis thaliana	sp\|Q9SUD3\|CX6B3_ARATH Cytochrome c oxidase subunit 6b-3	80.000%	Swiss-Prot	Medium
`Q945L0`	Arabidopsis thaliana	sp\|Q945L0\|CX6B2_ARATH Cytochrome c oxidase subunit 6b-2	77.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card