TkA01G414650 | RubberDandelionOmics

Gene overview

TkA01G414650

Reference: TK1151 Chr: Chr01 Coordinates: 103471751-103474185 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · TkA01G414650|TK1151|cDNA

CATGTCTCCTACAATCTCAAAATATCATTATTTTTATGCCACTTTTTGATATTTTATGTTCAATACCCACTTAATTTCGACGCCTTAGAGAGACTAGTAGCAAGATCACCATTGTTAAAGAAGCTTAGATTGAACCGTTACGTTTCGATAGGGCAGCTATACCGGTTAATTCTCCGGGCACCGCAGTTAACTCATTTGGGCACCGGTTCATTTAGTCCATTGGATATCAACGATCAACAACAAGAGCCCGATTACAGTTC...

CDS

Download CDS FASTA

966 bp · TkA01G414650|TK1151|CDS

CATGTCTCCTACAATCTCAAAATATCATTATTTTTATGCCACTTTTTGATATTTTATGTTCAATACCCACTTAATTTCGACGCCTTAGAGAGACTAGTAGCAAGATCACCATTGTTAAAGAAGCTTAGATTGAACCGTTACGTTTCGATAGGGCAGCTATACCGGTTAATTCTCCGGGCACCGCAGTTAACTCATTTGGGCACCGGTTCATTTAGTCCATTGGATATCAACGATCAACAACAAGAGCCCGATTACAGTTC...

Protein

Download Protein FASTA

321 aa · TkA01G414650|TK1151|PROTEIN

HVSYNLKISLFLCHFLIFYVQYPLNFDALERLVARSPLLKKLRLNRYVSIGQLYRLILRAPQLTHLGTGSFSPLDINDQQQEPDYSSAFAACRSIVCLSGFREISPEHLPAIYPVCANLTSLNLSYANIEPHQLRPAIRYCHKLQVFWSLLIIDLVYSPKKKESWLLKKRGSKRMLLAVLIANSEGNILVERFNGVPGEERLHWRSFLVKLGADNLKGVKNEELLVACHKSVYIVYTVLGHVSIYLVGKDEYDELALSEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G414650`
TK1151 ID	TkA01G414650
OH-1004 ID	LXL04_018894
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.800
Protein coverage (%)	TK1151 53.894 / OH-1004 94.241 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G414650

Location Chr01:103471751-103474185 (+)

Description Similar to tstD: TSET complex member tstD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49980`	Transport inhibitor response 1-like protein.	No verified direct reference in this release
`At4g24390`	F-box protein FBX14.	No verified direct reference in this release
`At1g12820`	Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity).	No verified direct reference in this release
`At3g26810`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0395600`	Transport inhibitor response 1-like protein Os04g0395600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0060098 membrane reorganization involved in phagocytosis, engulfment Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.417

Rank 1 · TkA01G414650 · TK1151

Cytoplasm0.326

Rank 2 · TkA01G414650 · TK1151

Endoplasmic reticulum0.154

Rank 3 · TkA01G414650 · TK1151

Cell membrane0.115

Rank 4 · TkA01G414650 · TK1151

Golgi apparatus0.110

Rank 5 · TkA01G414650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01972SDH_protease9-80 aa

PF24758LRR_At5g5637027-69 aa

PF24758LRR_At5g5637081-147 aa

PF01972SDH_protease144-171 aa

PF01217Clat_adaptor_s175-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G414650	`PF01972`	SDH_protease	9	80	0.34	10.6
TkA01G414650	`PF24758`	LRR_At5g56370	27	69	0.0012	19.2
TkA01G414650	`PF24758`	LRR_At5g56370	81	147	0.0012	19.2
TkA01G414650	`PF01972`	SDH_protease	144	171	0.34	10.6
TkA01G414650	`PF01217`	Clat_adaptor_s	175	311	0.018	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX2`	Arabidopsis thaliana	sp\|Q9LTX2\|TIR1L_ARATH Transport inhibitor response 1-like protein	68.700%	Swiss-Prot	Low
`Q8RWQ8`	Arabidopsis thaliana	sp\|Q8RWQ8\|FBX14_ARATH F-box protein FBX14	65.600%	Swiss-Prot	Low
`Q9LPW7`	Arabidopsis thaliana	sp\|Q9LPW7\|AFB3_ARATH Protein AUXIN SIGNALING F-BOX 3	48.100%	Swiss-Prot	Low
`Q9LW29`	Arabidopsis thaliana	sp\|Q9LW29\|AFB2_ARATH Protein AUXIN SIGNALING F-BOX 2	49.200%	Swiss-Prot	Low
`Q7XVM8`	Oryza sativa subsp. japonica	sp\|Q7XVM8\|TIR1B_ORYSJ Transport inhibitor response 1-like protein Os04g0395600	46.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card