TkA01G394610 | RubberDandelionOmics

Gene overview

TkA01G394610

Reference: TK1151 Chr: Chr01 Coordinates: 98419106-98422330 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1103 bp · TkA01G394610|TK1151|cDNA

ATCAGACAACTAGTGGGAAAGGCTAAAGAGCTTCAGTTCATTCCTGCATTATCTTTAGCTGATCCAGTAATTATCTTGCAGTTTCACATGAAACTGGGAATGGAGTTGTGGGGATATGCATGAATCATATGCCATGTGAGGTTCAAAAACAGAGATGTGAAAGCTTTGATTGTTCAGCAGCACATGCAATTGAACCAAGAACTGGAATTGAATTCCCGACTTTATTGGATAACATATTTGGAGGGACTAATTCCAGTTTA...

CDS

Download CDS FASTA

1164 bp · TkA01G394610|TK1151|CDS

ATGGATCTTGATGAGGGGCGGCCTAAGTTCTTTCCAGTGGAAGCTCTTTCCCCAAGTCGATACATATACCATATATCTTCACTGGTTGACATTTCACCCAATCATTCTAGACACTGGTACACCCCTGGAAGTCTTGCTCTTCAAGAAACCTTTAGAAACCTCTCAAAGTTTACAGGCACTGTTCTCTTATGGTGCTCTAATGGCTCAAATTCAAACATCACCCACAAAAGATATCAAGTTTCTGTCCAAAACAATTACAC...

Protein

Download Protein FASTA

387 aa · TkA01G394610|TK1151|PROTEIN

MDLDEGRPKFFPVEALSPSRYIYHISSLVDISPNHSRHWYTPGSLALQETFRNLSKFTGTVLLWCSNGSNSNITHKRYQVSVQNNYTKIALEIPEFFHKFSRFAIRQLVGKAKELQFIPALSLAGNLVPPLDNISSNYLAVSHETGNGVVGICMNHMPCEVQKQRCESFDCSAAHAIEPRTGIEFPTLLDNIFGGTNSSLNTEVLVGTGAKTMKIVKIKSLKLYAFGFYVHPYDICNKLGSRYASLPKDEVNKHHNFYAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G394610`
TK1151 ID	TkA01G394610
OH-1004 ID	LXL04_003090
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G394610

Location Chr01:98419106-98422330 (-)

Description Similar to FAP2: Fatty-acid-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26310`	Fatty-acid-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005504 fatty acid binding Molecular Function

GO:0016872 intramolecular lyase activity Molecular Function

GO:0045430 chalcone isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53520

ath:AT2G26310

ath:AT3G63170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.832

Rank 1 · TkA01G394610 · TK1151

Mitochondrion0.147

Rank 2 · TkA01G394610 · TK1151

Cytoplasm0.071

Rank 3 · TkA01G394610 · TK1151

Nucleus0.060

Rank 4 · TkA01G394610 · TK1151

Cell membrane0.026

Rank 5 · TkA01G394610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00754F5_F8_type_C27-89 aa

PF02431Chalcone198-380 aa

PF16035Chalcone_2204-376 aa

PF16036Chalcone_3220-230 aa

PF16036Chalcone_3256-375 aa

PF07177Neuralized279-362 aa

PF00754F5_F8_type_C282-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G394610	`PF00754`	F5_F8_type_C	27	89	0.24	12.3
TkA01G394610	`PF02431`	Chalcone	198	380	1.8e-05	25.0
TkA01G394610	`PF16035`	Chalcone_2	204	376	9.9e-21	75.2
TkA01G394610	`PF16036`	Chalcone_3	220	230	2.1e-07	31.9
TkA01G394610	`PF16036`	Chalcone_3	256	375	2.1e-07	31.9
TkA01G394610	`PF07177`	Neuralized	279	362	0.099	13.3
TkA01G394610	`PF00754`	F5_F8_type_C	282	303	0.24	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RK2`	Arabidopsis thaliana	sp\|Q84RK2\|FAP2_ARATH Fatty-acid-binding protein 2	47.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card