TkA01G391140 | RubberDandelionOmics

Gene overview

TkA01G391140

Reference: TK1151 Chr: Chr01 Coordinates: 97670886-97673618 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1868 bp · TkA01G391140|TK1151|cDNA

AAGACCGGTATCGGTCCGGAACGGACAATGTCACCGCACCGGCCCGCTCCCCATTTGTTTCCGGTTTCTCTAGAAAGTACATACTATAAAAAGAAAAACCCTGGCCCATATCCGGTTTCTTCGTACGGGAAACCCGCCGGACGCCGGCCATGGTTGATTGCCACGCTTGTAGCAGCTTACGGCTATCTATCTTTCCAACGACCACCATCGCCGCTGCCTCCAACTCCTCCCACTCCTCCGTGTTTGCCATCAAGTTTTCA...

CDS

Download CDS FASTA

1545 bp · TkA01G391140|TK1151|CDS

ATGGTTGATTGCCACGCTTGTAGCAGCTTACGGCTATCTATCTTTCCAACGACCACCATCGCCGCTGCCTCCAACTCCTCCCACTCCTCCGTGTTTGCCATCAAGTTTTCACCGAAGTCCGCATTTCCATTTCTCAGAAACACCATTGGATTAGCCTCTTGTCGCCGTCGTCGAATAATTCACGCAGCTGCGTCCACGGGTAGAAGTACCAGCAGTACTACTCCTGACTACTACAAAGTTCTTAACGTTCGTAGAAATGC...

Protein

Download Protein FASTA

514 aa · TkA01G391140|TK1151|PROTEIN

MVDCHACSSLRLSIFPTTTIAAASNSSHSSVFAIKFSPKSAFPFLRNTIGLASCRRRRIIHAAASTGRSTSSTTPDYYKVLNVRRNATLQEIKSSYRALARKYHPDMNKSDGAEEKFKEIGAAYEVLSDEEKRSIYDRFGEAGLQGEYDGSGTGFQEVDPFEVFGSFFGDSNGVFGGMNEPEGDSFSFRSKGSQTLNIRHDVFLSFEESIFGAKRDIEVSCLETCDYCGGSGAKSSKCIITCNRCGGRGAVMQTQETPFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G391140`
TK1151 ID	TkA01G391140
OH-1004 ID	LXL04_003123
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G391140

Location Chr01:97670886-97673618 (-)

Description Similar to DJA8: Chaperone protein dnaJ A8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22360`	May function together with HSC70 chaperone to assist protein folding and prevent protein aggregation during heat stress in the chloroplast.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003123 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G22360

dosa:Os05g0333500

dosa:Os05g0334400

osa:107275576

osa:4338449

osa:4338452

tel:tll0790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.747

Rank 1 · TkA01G391140 · TK1151

Mitochondrion0.140

Rank 2 · TkA01G391140 · TK1151

Cytoplasm0.075

Rank 3 · TkA01G391140 · TK1151

Nucleus0.055

Rank 4 · TkA01G391140 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA01G391140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ76-137 aa

PF30912TIM141_C79-119 aa

PF01556DnaJ_C198-416 aa

PF17302DUF5351223-233 aa

PF15777Anti-TRAP223-252 aa

PF27659CHP02642224-257 aa

PF00684DnaJ_CXXCXGXG225-289 aa

PF17302DUF5351241-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G391140	`PF00226`	DnaJ	76	137	9.2e-27	93.7
TkA01G391140	`PF30912`	TIM141_C	79	119	0.25	12.1
TkA01G391140	`PF01556`	DnaJ_C	198	416	4.4e-35	121.7
TkA01G391140	`PF17302`	DUF5351	223	233	0.0036	18.3
TkA01G391140	`PF15777`	Anti-TRAP	223	252	1.6	9.5
TkA01G391140	`PF27659`	CHP02642	224	257	8.1	6.6
TkA01G391140	`PF00684`	DnaJ_CXXCXGXG	225	289	1.5e-11	45.1
TkA01G391140	`PF17302`	DUF5351	241	250	0.0036	18.3
TkA01G391140	`PF27659`	CHP02642	262	294	8.1	6.6
TkA01G391140	`PF15777`	Anti-TRAP	267	291	1.6	9.5
TkA01G391140	`PF17302`	DUF5351	268	276	0.0036	18.3
TkA01G391140	`PF17302`	DUF5351	282	292	0.0036	18.3
TkA01G391140	`PF28118`	KPN01023	490	514	0.0096	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJZ7`	Arabidopsis thaliana	sp\|Q9SJZ7\|DNJA6_ARATH Chaperone protein dnaJ A6, chloroplastic	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card